IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysis of MADS box protein-protein interactions in living plant cells. Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Analysis of MADS box protein-protein interactions in living plant cells. Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. pethy-leaf Petunia leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Analysis of MADS box protein-protein interactions in living plant cells. Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. pethy-leaf Petunia leaf leaf fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 agl9_pethy Agamous-like MADS-box protein AGL9 homolog Floral homeotic protein FBP2 Floral-binding protein 2 FBP2 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITVGGAGPSVNNYMAGWLP B575BE9468D310BB q9atf2_pethy FBP5 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFSSTSNMVKTLDRYQKCSYGTLEVNHRSVKDNNEERIYREYLKLKAKYESLQRYQRQLLGDELGPLNIDELEHLELQLDSSLKLIKSTRTQLMLDQLSDLQTKEKLWVEANKVLERKLEQIYAENNIQQSWGGGEQSGAYGQQHAQTQGFFQPLECNSTLQIGYDPATSSQITAVTSGQNVNGIIPGWML 4D069F5D26995B19 q40882_pethy fbp11 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYANNNIKGTIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQLLQNTNRHLVGEGLSALNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENTFLRSKIAENERLQELSMMPATGQEYNAFQQYFARNMLQLNMMEGGVPSYDPLPAHDKKSLQLE 1658ABF23C1FC7AE q9atf1_pethy FBP9 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSTSSMMKTLEKYQQCSYASLDPMQSANDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGSLNSKELEQLEHQLDSSLKQIRSKKTQHMLDQLADLQQKEQMLAEANKQLRRKLEESAARIPLRLSWDNGGQPMQHNRLPPQTEGFFQPLGLNSSSPQFGYSPMGANEVNNAVSTAQNMNGFIPGWML D6C1AE9E1AD53C38 fbp11-fbp2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association fbp11-fbp5 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association fbp11-fbp9 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association fbp11-fbp2-1 2 4 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization fbp11-fbp5-1 2 5 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization fbp11-fbp9-1 2 6 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization fbp11-fbp2-2 3 6 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction fbp11-fbp5-2 3 5 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction fbp11-fbp9-2 3 7 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction fbp9-fbp9 3 7 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction fbp5-fbp5 3 5 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction fbp2-fbp2 3 4 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction