IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). J. Biol. Chem. (0021-9258) 2002 Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). J. Biol. Chem. (0021-9258) 2002 Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). J. Biol. Chem. (0021-9258) 2002 Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). J. Biol. Chem. (0021-9258) 2002 Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). J. Biol. Chem. (0021-9258) 2002 Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 70C2AE0DC654D031 xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS DIP protein P55211 original sequence version: 174 DIP protein P55211 original sequence version: 167 DIP protein P55211 original sequence version: 124 DIP protein P55211 original sequence version: 125 DIP protein P55211 original sequence version: 123 DIP protein P55211 original sequence version: 153 78E0180DF2A3BDD2 htra2_human Serine protease HTRA2, mitochondrial High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 HTRA2 PRSS25 OMI protein protein human Homo sapiens Human MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE CEA955A7D0DD8C0D birc7_human Baculoviral IAP repeat-containing protein 7 Kidney inhibitor of apoptosis protein Melanoma inhibitor of apoptosis protein Livin RING finger protein 50 UNQ5800/PRO19607/PRO21344 BIRC7 KIAP LIVIN MLIAP RNF50 RING-type E3 ubiquitin transferase BIRC7 protein protein human Homo sapiens Human MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS B2EAAEE531BEC101 birc4-diablo-1 2 6 unspecified role unspecified role prey prey cleavage region necessary required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association birc7-casp9-2 3 8 unspecified role unspecified role bait bait biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role prey prey bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association birc7-diablo-3 3 6 unspecified role unspecified role prey prey biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association birc7-prss25-1 3 9 unspecified role unspecified role bait bait peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role prey prey bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association birc4-prss25-2 3 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role bait bait peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association birc4-diablo-4 3 7 unspecified role unspecified role bait bait bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association birc4-casp9-3 3 8 unspecified role unspecified role bait bait biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association birc7-diablo-2 2 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cleavage region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association birc7-casp9-3 1 10 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role neutral component neutral component fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association birc7-prss25-2 1 9 unspecified role unspecified role neutral component neutral component fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role neutral component neutral component bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association birc7-diablo-4 1 10 unspecified role unspecified role neutral component neutral component bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association birc4-prss25-3 1 7 unspecified role unspecified role neutral component neutral component bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association birc4-diablo-5 1 6 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role neutral component neutral component bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association birc4-casp9-4 1 8 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role neutral component neutral component bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association birc7-casp9-1 2 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:05:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp138ala' Tue Jun 30 18:09:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp138Ala' physical association physical association ML-IAP coimmunoprecipitated processed caspase-9 (P35) but not its zymogen precursor Overexpression of SMAC (Q9NR28) inhibits interaction. SMAC competes with Caspase 9 for binding to ML-IAP. birc7-diablo-6 2 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CA5:p.Asp120Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:52:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp120ala' Tue Jun 30 16:08:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp120Ala' Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:49:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp138ala' Tue Jun 30 17:21:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp138Ala' physical association physical association birc7-diablo-7 4 6 unspecified role unspecified role bait bait biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A Wed May 02 14:34:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp138ala' Tue Jun 30 19:08:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp138Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association birc4-diablo-2 4 6 unspecified role unspecified role bait bait peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association birc7-diablo-8 5 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:55:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp138ala' Tue Jun 30 17:52:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp138Ala' 6 unspecified role unspecified role prey prey physical association physical association MCF-7 cells stably express ML-IAP WT or ML-IAP D138A mutant. SMAC is endogenous