IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. EMBO J. (0261-4189) 2001 imex curation Fu H., Reis N., Lee Y., Glickman MH., Vierstra RD. Figure 8 provides a diagram of proposed interaction maps from data. Directed yeast two hybrid assay using HIS3 and LacZ reporter genes was employed in this study. Figure 1. Figure 2. Figure 3. hongyong@gate.sinica.edu.tw Only protein-protein interactions imex curation in vitro In vitro chromatography chromatography technology column chromatography chromatography western blot western blot Immuno blot Immuno blot Fu H., Reis N., Lee Y., Glickman MH., Vierstra RD. Figure 8 provides a diagram of proposed interaction maps from data. Directed yeast two hybrid assay using HIS3 and LacZ reporter genes was employed in this study. Figure 1. Figure 2. Figure 3. hongyong@gate.sinica.edu.tw Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2001 IMEx Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. EMBO J. (0261-4189) 2001 imex curation Fu H., Reis N., Lee Y., Glickman MH., Vierstra RD. Figure 8 provides a diagram of proposed interaction maps from data. Directed yeast two hybrid assay using HIS3 and LacZ reporter genes was employed in this study. Figure 1. Figure 2. Figure 3. hongyong@gate.sinica.edu.tw Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu H., Reis N., Lee Y., Glickman MH., Vierstra RD. Figure 8 provides a diagram of proposed interaction maps from data. Directed yeast two hybrid assay using HIS3 and LacZ reporter genes was employed in this study. Figure 1. Figure 2. Figure 3. hongyong@gate.sinica.edu.tw Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2001 IMEx prs4_yeast 26S proteasome regulatory subunit 4 homolog RPT2 YHS4 YTA5 YDL007W D2920 Tat-binding homolog 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL EB735354C3A0EBD4 EB735354C3A0EBD4 csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH D182ABACE4238759 prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F 9C59E92A0794F60F rpn12_yeast 26S proteasome regulatory subunit RPN12 RPN12 NIN1 Nuclear integrity protein 1 YFR052W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV D901AAD4D07ED3D1 D901AAD4D07ED3D1 q94ju3-2 COP9 signalosome complex subunit 7 CSN7i CSN7 FUS5 Protein FUSCA 5 T7I23.24 T7I23.25 At1g02090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKRE B15D2B6031AFC27D prs7_yeast 26S proteasome regulatory subunit 7 homolog YKL145W RPT1 CIM5 YTA3 Protein CIM5 Tat-binding homolog 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 8454BBC9D549EC5C 8454BBC9D549EC5C rpn3_yeast 26S proteasome regulatory subunit RPN3 RPN3 SUN2 YER021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MASTAVMMDVDSSGVNDLHHSEKKYAEEDQVQELLKVLNEISKTTLTLDPRYIWRSLKDLSSLRNQELLNAETLCFTVNVLYPDSSSFKKNLLKFITSNHKSSVPGSAELRNSYPASFYSVNTEKKTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGFL B08B58663DDA85DC B08B58663DDA85DC rpn8_yeast 26S proteasome regulatory subunit RPN8 RPN8 O5360 YOR261C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN 6EE6009545A3D0EF 6EE6009545A3D0EF csn1_arath COP9 signalosome complex subunit 1 Constitutive photomorphogenesis protein 11 Protein FUSCA 6 CSN1 COP11 FUS6 At3g61140 T20K12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL C2A980E744B23A90 csn3_arath COP9 signalosome complex subunit 3 Protein FUSCA 11 CSN3 FUS11 At5g14250 F18O22.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGAVNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGLVKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 77AD165F559BCE12 rpn5_yeast 26S proteasome regulatory subunit RPN5 RPN5 NAS5 YDL147W D1572 Proteasome non-ATPase subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK E5DC7F8E6AE27736 E5DC7F8E6AE27736 csn6b_arath COP9 signalosome complex subunit 6b CSN6B At4g26430 M3E9.140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPSSSSGLTFKLHPLVMLNISDHFTRVKTQLNPPAASCATGNGSNNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIFDPALDTLDRSFLEKKQELYKKVFPDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFHVIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLNSRIRVLYQHIVAMQKGDKPCENSVLRQVSSLLRSLPAAESEKFNENFLMEYNDKLLMSYLAMITNCTSNMNEVVDKFNTAYDKHSRRGGRTAFM 9629A50F9EDA2C0E rpn1_yeast 26S proteasome regulatory subunit RPN1 RPN1 HRD2 NAS1 RPD1 Proteasome non-ATPase subunit 1 HMG-CoA reductase degradation protein 2 YHR027C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDESDKKQQTIDEQSQISPEKQTPNKKDKKKEEEEQLSEEDAKLKTDLELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPKNVKGEEDADEEETAEGQTNSISDFLGEQVNEPTKNEEAEIEVDEMEVDAEGEEVEVKAEITEKKNGESLEGEEIKSEEKKGKSSDKDATTDGKNDDEEEEKEAGIVDELAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE B77954F4A998BA7C B77954F4A998BA7C rpn7_yeast 26S proteasome regulatory subunit RPN7 RPN7 P8283.8 YPR108W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV B21B66CD818E636D B21B66CD818E636D rpn11_yeast Ubiquitin carboxyl-terminal hydrolase RPN11 YFR004W RPN11 MPR1 Protein MPR1 26S proteasome regulatory subunit RPN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK 9DDE8BD74890894D 9DDE8BD74890894D csn6a_arath COP9 signalosome complex subunit 6a CSN6A At5g56280 K24C1.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPSSSSGLTFKLHPLVIVNISDHYTRVKTQLNPPASICASGHGSNNGEAMFQQNPRVYGCVIGVQRGRTVEIFNSFELLYDPSTQTLDRSFLEKKQELYKKVFPDFYILGWYSTGSDAEESDMHIHKALMDINESPVYVLLNPAINHTQKDLPVTIYESELHVIDGIPQLIFAHTSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLNSRIRVLYQNLAAMQKGDKSCDNSVLRQVSSLLRRLPAMESERFQDNFLMEYNDKLLITYLAMITNCSSNMNEMVDKFNTAYDRNTRRGGRTAFM 27CC8E122C0457C3 csn4_arath COP9 signalosome complex subunit 4 Constitutive photomorphogenesis protein 8 Protein FUSCA 4 CSN4 COP8 FUS4 At5g42970 MBD2.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV 1E8AEF28C35B28F0 csn5b_arath COP9 signalosome complex subunit 5b CSN5B AJH2 CSN5A Jun activation domain-binding homolog 2 F3I17.12 At1g71230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWENDPHYFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQDDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTVSAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMITY 4890F2D35F6FB410 rpn9_yeast 26S proteasome regulatory subunit RPN9 RPN9 NAS7 YDR427W D9461.14 Proteasome non-ATPase subunit 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV 540F7DF8C23469A1 540F7DF8C23469A1 prs10_yeast 26S proteasome subunit RPT4 RPT4 CRL13 PCS1 SUG2 26S protease subunit SUG2 Proteasomal cap subunit YOR259C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 0EA42A599E2B2E2A 0EA42A599E2B2E2A rpn10_yeast 26S proteasome regulatory subunit RPN10 RPN10 MCB1 SUN1 YHR200W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSSGMGAFGGSGGDSDANGTFMDFGVDPSMDPELAMALRLSMEEEQQRQERLRQQQQQQDQPEQSEQPEQHQDK 8A05198B0CD7C0C3 8A05198B0CD7C0C3 prs6b_yeast 26S proteasome regulatory subunit 6B homolog RPT3 YNT1 YTA2 YDR394W D9509.14 Protein YNT1 Tat-binding homolog 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK E12F0995A60732BD E12F0995A60732BD csn5a_arath COP9 signalosome complex subunit 5a CSN5A AJH1 CSN5B Jun activation domain-binding homolog 1 F19G10.12 At1g22920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSSAIARKTWELENNILPVEPTDSASDSIFHYDDASQAKIQQEKPWASDPNYFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQSDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGGIAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMITS 08FAC28547FDEEFB q94ju3-1 COP9 signalosome complex subunit 7 CSN7ii CSN7 FUS5 Protein FUSCA 5 T7I23.24 T7I23.25 At1g02090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKGDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR CBBDA06097E44689 rpn6_yeast 26S proteasome regulatory subunit RPN6 RPN6 NAS4 YDL097C D2381 Proteasome non-ATPase subunit 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY A8B1F7E6F73A4024 A8B1F7E6F73A4024 prs6a_yeast 26S proteasome regulatory subunit 6A RPT5 YTA1 YOR117W O3258 YOR3258W Tat-binding protein homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA C215422033FCE830 C215422033FCE830 rpt1-rpt2-1 2 8 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpt3-rpt3-1 2 24 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey physical association physical association Low HIS3 reporter activity when binding domain fused to N-terminal of RPT3 protein. LacZ reporter acivity detected. rpt3-rpt5-1 2 24 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey physical association physical association Low HIS3 reporter activity detected when binding domain fused to N-terminal of RPT3 protein. LacZ reporter acivity detected. rpt3-rpt6-1 2 5 unspecified role unspecified role prey prey c terminal binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q01939:p.Lys195Arg Lys195Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:48:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys195arg' Tue Jun 30 16:41:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys195Arg' Q01939:p.Lys195Ser Lys195ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K S Wed May 02 16:10:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys195ser' Tue Jun 30 19:27:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys195Ser' 24 unspecified role unspecified role bait bait physical association physical association Both HIS3 and LacZ reporter activity detected. rpt4-rpt5-4 2 28 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association Both HIS3 and LacZ reporter acitivity detected. rpt1-rpn1-1 2 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpt2-rpt1-3 2 8 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn1-rpt1-26 2 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpt5-rpt3-1 2 28 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey physical association physical association Both HIS3 and LacZ reporter acitivity detected. rpt6-rpt3-20 2 24 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Both HIS3 and LacZ reporter activity detected. rpt5-rpt4-1 2 28 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey c terminal binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association rpn3-rpn7-8 2 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Rpn3 was shown to self-activate the HIS3 reporter. LacZ reporter activity detected. rpn7-rpn3-1 2 16 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association rpn5-rpn6-1 2 13 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn6-rpn5-17 2 13 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn5-rpn8-13 2 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association LacZ reporter activity not detected. HIS3 reporter acivity detected. rpn8-rpn5-7 2 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn5-rpn9-1 2 13 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association rpn9-rpn5-6 2 13 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association rpn5-rpn11-13 2 13 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth (in BD linked to C terminal of protein configuration) and LacZ reporter activity not detected rpn11-rpn5-3 2 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn8-rpn9-7 2 10 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth (in BD fused to N terminal of protein configuration) and LacZ reporter activity not detected rpn9-rpn8-5 2 10 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn8-rpn11-6 2 10 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth when binding domain fused to C-terminal of Rpn8 protein. LacZ reporter detected. rpn11-rpn8-2 2 17 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association HIS3 and LacZ reporter activity detected. rpn9-rpn11-1 2 21 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpn11-rpn9-4 2 17 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth and LacZ reporter activity not detected rpt12-rpt3-1 2 6 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey physical association physical association Rpn3 fused to binding domain showed self activation of the HIS3 reporter. LacZ reporter activity was not detected. csn1-csn7i-1 2 11 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth. LacZ reporter activity not detected csn1-csn7ii-1 2 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth. LacZ reporter activity not detected csn3-csn4-1 2 12 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth when Csn3 protein N terminal domain fused to binding domain. LacZ reporter activity not detected csn4-csn3-1 2 19 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth when Csn4 N terminal fused to inding domain. LacZ reporter activity not detected csn3-csn5a-1 2 20 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth when Csn3 N terminal domain fused to binding domain. LacZ reporter activity not detected csn3-csn5b-1 2 25 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association LacZ reporter activity not detected The CSN5B binding domain construct showed self activation of the HIS3 reporter. csn7i-csn3-1 2 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth when C terminal of Csn7i fused to binding domain. LacZ reporter activity not detected csn3-csn8-1 2 12 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth. LacZ reporter activity detected. csn8-csn3-1 2 4 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Low histidine auxotrophic growth when C terminal of Csn8 protein fused to binding domain. LacZ reporter activity detected. csn4-csn5a-1 2 20 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth detected when N terminal of Csn4 fused to binding domain. LacZ reporter activity not detected csn4-csn7i-1 2 19 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association csn4-csn7ii-1 2 19 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association csn7i-csn4-1 2 19 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait physical association physical association Both HIS3 and LacZ reporter activity detected. csn7ii-csn4-1 2 19 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Both LacZ and HIS3 reporter acitivity detected. csn6a-csn5a-1 2 18 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association The CSN5A binding domain construct showed self activation of the HIS3 reporter. csn6b-csn5a-1 2 14 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association The CSN5A binding domain construct showed self activation of the HIS3 reporter. csn6a-csn5b-1 2 25 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association The CSN5B binding domain construct showed self activation of the HIS3 reporter. csn6b-csn5b-1 2 14 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association The CSN5B binding domain construct showed self activation of the HIS3 reporter. csn7i-csn5a-1 2 7 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Histidine auxotropic growth detected. No LacZ reporter acitivity detected. csn7ii-csn5a-1 2 20 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait physical association physical association Histidine auxotrophic growth detected. No LacZ reporter activity detected. csn7i-csn5b-1 2 7 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association Histidine auxotrophic growth detected. No LacZ reporter acitivity detected. csn7ii-csn5b-1 2 25 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait physical association physical association Histidine auxotrophic growth detected. No LacZ reporter acitivity detected. csn8-csn5a-2 2 4 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity selected. csn8-csn5b-1 2 25 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association LacZ and HIS3 reporter activity detected. csn6a-csn6a-1 2 18 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Histidine auxotrophic growth detected. No LacZ reporter activity detected. csn6a-csn7i-1 2 18 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn7i-csn6a-1 2 7 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn6a-csn7ii-1 2 26 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Both LacZ and HIS3 reporter activity detected. csn7ii-csn6a-1 2 26 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn6b-csn7i-1 2 14 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn7i-csn6b-1 2 7 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn6b-csn7ii-1 2 14 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn7ii-csn6b-1 2 26 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn7ii-csn8-1 2 4 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait physical association physical association Both LacZ and HIS3 reporter activity detected. csn8-csn7ii-1 2 4 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn7i-csn8-1 2 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Both LacZ and HIS3 reporter activity detected. csn8-csn7i-1 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Both LacZ and HIS3 reporter activity detected. csn7i-csn1-1 2 11 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth when Csn7i C terminal region fused to binding domain. LacZ reporter activity not detected csn7ii-csn1-1 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Low histidine auxotrophic growth when Csn7ii C terminal region fused to binding domain. LacZ reporter activity not detected rpn10-rpn3-5 1 23 unspecified role unspecified role neutral component neutral component P38886:p.Asp11Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D R Wed May 02 17:32:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp11arg' Tue Jun 30 18:46:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp11Arg' 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association