IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction. Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction. Nature (0028-0836) 2001 Fitzgerald KA., Palsson-McDermott EM., Bowie AG., Jefferies CA., Mansell AS., Brady G., Brint E., Dunne A., Gray P., Harte MT., McMurray D., Smith DE., Sims JE., Bird TA., O'Neill LA. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fitzgerald KA., Palsson-McDermott EM., Bowie AG., Jefferies CA., Mansell AS., Brady G., Brint E., Dunne A., Gray P., Harte MT., McMurray D., Smith DE., Sims JE., Bird TA., O'Neill LA. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2001 Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction. Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction. Nature (0028-0836) 2001 Fitzgerald KA., Palsson-McDermott EM., Bowie AG., Jefferies CA., Mansell AS., Brady G., Brint E., Dunne A., Gray P., Harte MT., McMurray D., Smith DE., Sims JE., Bird TA., O'Neill LA. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fitzgerald KA., Palsson-McDermott EM., Bowie AG., Jefferies CA., Mansell AS., Brady G., Brint E., Dunne A., Gray P., Harte MT., McMurray D., Smith DE., Sims JE., Bird TA., O'Neill LA. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2001 myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP CEAE3F6B99524333 p58753-2 Toll/interleukin-1 receptor domain-containing adapter protein TIRAP MAL Adaptor protein Wyatt MyD88 adapter-like protein protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL DIP protein P58753-2 original sequence version: 119 DIP protein P58753-2 original sequence version: 129 383386AA03B70F32 tlr4_human Toll-like receptor 4 TLR4 hToll protein protein human Homo sapiens Human MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI 92C48F55821133E8 tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS DIP protein P58753 original sequence version: 119 44A8454D04704540 irak2_human Interleukin-1 receptor-associated kinase-like 2 IRAK2 protein protein human Homo sapiens Human MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQGQGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCPVNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRSPVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACLCLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDASSSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFGP DIP protein O43187 original sequence version: 90 715C954BC9452710 tirap-myd88 2 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association myd88-tirap 2 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association myd88 2 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association MyD88 was shown to interact intra-molecularly using directed yeast-2-hybrid analysis and authors state, but do not demonstrate. that this interaction arises from homodimer formation. tirap 2 4 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Mal was shown to interact intra-molecularly using directed yeast-2-hybrid analysis and authors state, but do not demonstrate. that this interaction arises from homodimer formation. myd88-tirap-1 1 3 unspecified role unspecified role bait bait tir domain TIR domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region AU tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tir domain TIR domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association tirap-irak2 1 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association tirap-tlr4 1 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association