IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Iron-sulfur cluster assembly: characterization of IscA and evidence for a specific and functional complex with ferredoxin. Iron-sulfur cluster assembly: characterization of IscA and evidence for a specific and functional complex with ferredoxin. J. Biol. Chem. (0021-9258) 2001 Ollagnier-de-Choudens S., Mattioli T., Takahashi Y., Fontecave M. E. coli crude extract was loaded on a affinity column were the histidine tagged protein was attached. The prey was identified after SDS-PAGE and N-terminal sequencing. fig 3 mfontecave@cea.fr in vitro In vitro pull down pull down partial id prot seq partial identification of protein sequence partial id prot seq Ollagnier-de-Choudens S., Mattioli T., Takahashi Y., Fontecave M. E. coli crude extract was loaded on a affinity column were the histidine tagged protein was attached. The prey was identified after SDS-PAGE and N-terminal sequencing. fig 3 mfontecave@cea.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 Iron-sulfur cluster assembly: characterization of IscA and evidence for a specific and functional complex with ferredoxin. Iron-sulfur cluster assembly: characterization of IscA and evidence for a specific and functional complex with ferredoxin. J. Biol. Chem. (0021-9258) 2001 Ollagnier-de-Choudens S., Mattioli T., Takahashi Y., Fontecave M. E. coli crude extract was loaded on a affinity column were the histidine tagged protein was attached. The prey was identified after SDS-PAGE and N-terminal sequencing. fig 3 mfontecave@cea.fr in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Ollagnier-de-Choudens S., Mattioli T., Takahashi Y., Fontecave M. E. coli crude extract was loaded on a affinity column were the histidine tagged protein was attached. The prey was identified after SDS-PAGE and N-terminal sequencing. fig 3 mfontecave@cea.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 fer_ecoli 2Fe-2S ferredoxin fdx b2525 JW2509 protein protein ecoli Escherichia coli (strain K12) MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAREH DIP protein P0A9R4 original sequence version: 47 F7B3240F950DC0E0 isca_ecoli Iron-binding protein IscA yfhF Iron-sulfur cluster assembly protein iscA b2528 JW2512 protein protein ecoli Escherichia coli (strain K12) MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV CBA945AD547E77DD isca-fd-1 1 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association The iron-sulfur cluster [2Fe-2S] in IscA is required for interaction as ApoIscA does not pull-down Ferredoxin. isca-fd-2 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 4 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) physical association physical association Apoferredoxin becomes holoferredoxin by binding [2Fe-2S] iron sulfur binding