IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J. Biol. Chem. (0021-9258) 2001 Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J. Biol. Chem. (0021-9258) 2001 Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J. Biol. Chem. (0021-9258) 2001 Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J. Biol. Chem. (0021-9258) 2001 Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J. Biol. Chem. (0021-9258) 2001 Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shao J., Grammatikakis N., Scroggins BT., Uma S., Huang W., Chen JJ., Hartson SD., Matts RL. Radiolabelled eIF2AK1 (HRI) identified by autoradiography 1, 3 & 5C Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2001 cdc37_human Hsp90 co-chaperone Cdc37 CDC37 Hsp90 chaperone protein kinase-targeting subunit p50Cdc37 CDC37A protein protein human Homo sapiens Human MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV DIP protein Q16543 original sequence version: 156 55BFEFFF3C2A5442 if2a_rabit Eukaryotic translation initiation factor 2 subunit 1 Eukaryotic translation initiation factor 2 subunit alpha EIF2S1 EIF2A protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit PGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGRILLSELSR 52E63D8DCEA6B804 hsp90_rabit Heat shock protein HSP 90 Eukaryotic peptide initiation factor 2 kinase, alpha-chain-associated phosphopeptide protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MPEEVQTQDQPMETFAVQTFAFQAEIAQLMSLIYESLTDPSKLDSGK 72E9934BA144C184 g1tpn2_rabit CDC37 protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKQLEVAEGGQAGQSRFMAEAQQLRKEERSWEQKLEEMRKKEKSLPWNVDTLSKDGFSKVRGGACLGGPAEDAPHRRPPLICPKAPAHAPASLLLMAPSTWTQPTPLLTHPQSMVNTKPEKARAAPVRSSSAECALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERRKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPADAKYHMQRCIDSGLWVPNSKSSESKEGAGVGPGDPLLDAAPKAGAEEDTSA The sequence has been withdrawn from uniprot. B2F63678D3DBF03D e2ak1_human Eukaryotic translation initiation factor 2-alpha kinase 1 Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase Hemin-sensitive initiation factor 2-alpha kinase Heme-regulated inhibitor Heme-controlled repressor EIF2AK1 HRI KIAA1369 PRO1362 protein protein human Homo sapiens Human MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVIQPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKEKRFGESDTENQNNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSHLEESFTSTEESSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVATKIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRNGKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGLRTGQLPESLRKRCPVQAKYIQHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQEKEIAELKKQLNLLSQDKGVRDDGKDGGVG D63021651806620B e2ak1_rabit Eukaryotic translation initiation factor 2-alpha kinase 1 Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase Hemin-sensitive initiation factor 2-alpha kinase Heme-regulated inhibitor Heme-controlled repressor EIF2AK1 HRI protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MLGGSAGTRGGEAEGDGAGAVGAVAPPPAIDFPAEVSDPKYDESDVPAELQVLKEPLQQPAFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSARERVRQDPCADNSHIQKIRSREVALEAQTSRYLNEFEELSILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVHVQADRVPIQLPSLEVLSDQEEDRDQYGVKNDASSSSSIIFAEFSPEKEKSSDECAVESQNNKLVNYTTNLVVRDTGEFESSTERQENGSIVERQLLFGHNSDVEEDFTSAEESSEEDLSALRHTEVQYHLMLHIQMQLCELSLWDWIAERNRRSRECVDESACPYVMVSVATKIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQKNAARTSRNGERAPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSVGVILLELFQPFGTEMERAEVLTGVRAGRIPDSLSKRCPAQAKYVQLLTRRNASQRPSALQLLQSELFQNSAHVNLTLQMKIIEQEREIEELKKQLSLLSQARGVRSDRRDGELPA 4E47CC0173289B57 hs90b_human Heat shock protein HSP 90-beta HSP90AB1 HSP90B HSPC2 HSPCB Heat shock 84 kDa protein protein human Homo sapiens Human MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRMEEVD DIP protein P08238 original sequence version: 91 DIP protein P08238 original sequence version: 149 DIP protein P08238 original sequence version: 165 DIP protein P08238 original sequence version: 167 DIP protein P08238 original sequence version: 210 DIP protein P08238 original sequence version: 187 A93118C214D03810 eif2ak1-cdc37-1 3 9 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 8 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 11 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Hemin - its absence causes HRI to autophosphorylate which disrupts interaction eif2ak1-cdc37-2 3 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association hsp90-cdc37-3 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association hsp90-cdc37-4 5 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 unspecified role unspecified role bait bait rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association eif2ak1-cdc37-5 5 9 unspecified role unspecified role bait bait rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Hemin - an absence of causes HRI to autophosphorylate which disrupts interaction eif2ak1-cdc37-6 3 8 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Geldanamycin - inhibits Hsp90 function, disrupts the direct recognition of kinase molecules by cdc37 eif2ak1-cdc37-7 3 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association eif2ak1-eif2s1-1 2 7 enzyme target enzyme target substrate substrate unspecified role unspecified role rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 11 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro phosphorylation phosphorylation reaction phosphorylation Physical association with CDC37 appears to enhance eIF2AK1 maturation and increase kinase activity eif2ak1-cdc37-8 1 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Geldamycin - inhibits Hsp90 function, disrupts the direct recognition of kinase molecules by cdc37