MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Science (0036-8075) 2000 Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status rat Rattus norvegicus (Rat) Rat imaging technique imaging technique microscopy western blot western blot Immuno blot Immuno blot Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status Science (0036-8075) 2000 Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Science (0036-8075) 2000 Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status Science (0036-8075) 2000 Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Science (0036-8075) 2000 Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status Science (0036-8075) 2000 Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Science (0036-8075) 2000 Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status Science (0036-8075) 2000 Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Kinesin superfamily motor protein KIF17 and mLin-10 in NMDA receptor-containing vesicle transport. Science (0036-8075) 2000 Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Setou M., Nakagawa T., Seog DH., Hirokawa N. no no status Science (0036-8075) 2000 kif17_mouse Kinesin-like protein KIF17 Kif17 protein protein mouse Mus musculus Mouse MASESVKVVVRCRPMNKRERELSCQSVVTVDSARGQCFIQNPGAADEPPKQFTFDGAYYIEHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPCQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVHDLLGADTKQRLELKEHPEKGVYVKGLSMHTVHNVAQCERVMETGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPRINEDPKDALLREYQEEIKRLKAILAQQMGPGNLSALLSTQTPPGPVQSEEKLLSPTTVQQDTEAEKQLIREEYEERLARLKADYEAEQESRVRLQEDITAMRNSYDVKLSTLQENLRKEKETEAILKAEVLCKTEVMSRAELASGPEYSPPLQYETAVKPTILSMPDMPPSGKVTKSQAPLAFEEPHGETSRSEFSFESNECSTLEDSATSEAFPGPEEFSNMEFSMAAALTESRYLPEEYLGGQEAAASPLEAERYVQENEPSLEPLRILASLQDPFAEVEAKLARLSSTVAMSDSSQTVVPQIPKQPSSADLLEPSDTKSEADVAVADNVVLGTEPDVNLRVAEEVVSEAETGVWMESEAQVAHVAQVSEEAQPQPLLAMVSVRRESVGVEVAVLTEEELQPVDQQQVLARLQLLEQQVVGGEQAKNKDLREKHKRRKRYADERKKQLVAALQNSDEDGGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLEQVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLPVVPTGTQNKPARKTSAVDSGEPHMQEEDRYKLMLSRSDSENIASNYFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALPPTQTPEMPQPRPFRLESLDIPFSKAKRKKSKNSFGGEPL DIP protein Q99PW8 original sequence version: 106 2BED852A3AFDBD46 apba1_rat Amyloid-beta A4 precursor protein-binding family A member 1 Neuron-specific X11 protein Neuronal Munc18-1-interacting protein 1 Adapter protein X11alpha Apba1 Mint1 X11 protein protein rat Rattus norvegicus (Rat) Rat MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPPPPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI 57F6EEA458376CAD apba1-kif17 5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz1 Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4C PDZ 3 picomolar homomint mint apba1-kif17-1 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-419019: original sequence: 957-1038 : IASNYFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALPPTQTPEMPQPRPFRLESLDIPFSKAKRKKSKNSFGGEP Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain pdz1 range MINT-419009: original sequence: 658-744 : DVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association PDZ F4AF4B homomint mint kif17-apba1 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz1 Stoichiometry: 1.0 physical association physical association PDZ F4D homomint mint apba1-kif17-2 2 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz1 Stoichiometry: 1.0 physical association physical association PDZ F4E homomint mint apba1-kif17-3 1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz1 Stoichiometry: 1.0 colocalization colocalization F6 PDZ homomint mint