IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bax oligomerization is required for channel-forming activity in liposomes and to trigger cytochrome c release from mitochondria. Bax oligomerization is required for channel-forming activity in liposomes and to trigger cytochrome c release from mitochondria. Biochem. J. (0264-6021) 2000 Antonsson B., Montessuit S., Lauper S., Eskes R., Martinou JC. Apoptosis - Interactions involving proteins with a function related to apoptosis E. coli cells disrupted in buffer containing 1% Triton X-100 bruno.antonsson.ch-gva03@serono.com ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Antonsson B., Montessuit S., Lauper S., Eskes R., Martinou JC. Apoptosis - Interactions involving proteins with a function related to apoptosis E. coli cells disrupted in buffer containing 1% Triton X-100 bruno.antonsson.ch-gva03@serono.com Annotation to indicate that this entry has been checked and accepted by a senior curator. Biochem. J. (0264-6021) 2000 Bax oligomerization is required for channel-forming activity in liposomes and to trigger cytochrome c release from mitochondria. Bax oligomerization is required for channel-forming activity in liposomes and to trigger cytochrome c release from mitochondria. Biochem. J. (0264-6021) 2000 Antonsson B., Montessuit S., Lauper S., Eskes R., Martinou JC. Apoptosis - Interactions involving proteins with a function related to apoptosis E. coli cells disrupted in buffer containing 1% Triton X-100 bruno.antonsson.ch-gva03@serono.com mouse-liver Mus musculus liver liver molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Antonsson B., Montessuit S., Lauper S., Eskes R., Martinou JC. Apoptosis - Interactions involving proteins with a function related to apoptosis E. coli cells disrupted in buffer containing 1% Triton X-100 bruno.antonsson.ch-gva03@serono.com Annotation to indicate that this entry has been checked and accepted by a senior curator. Biochem. J. (0264-6021) 2000 bax_mouse Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG D2E0B3566579FAFF bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 baxa-1 1 4 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association In the presence of 2%OG in the migration buffer BaxDC migrated as an oligomer of approx. 160000 Da. In the absence of detergent migrated at a molecular mass of 22000 Da (monomeric). Need stoichiometry=oligomer to describe this baxa-2 2 3 unspecified role unspecified role neutral component neutral component physical association physical association in the absence of detergent, Bax migrated as a 24000-Da protein (monomer). After pre-incubation of the cytosol with 2% OG, Bax migrated with a molecular mass of 140000 in the presence of 2% OG in the migration buffer Need stoichiometry=oligomer to describe this