IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis cop8 and fus4 mutations define the same gene that encodes subunit 4 of the COP9 signalosome. Arabidopsis cop8 and fus4 mutations define the same gene that encodes subunit 4 of the COP9 signalosome. Plant Cell (1040-4651) 1999 Serino G., Tsuge T., Kwok S., Matsui M., Wei N., Deng XW. revisit when wei reference is avaliable - ordered through paperbase yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Serino G., Tsuge T., Kwok S., Matsui M., Wei N., Deng XW. revisit when wei reference is avaliable - ordered through paperbase Directed yeast-2-hybrid Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant Cell (1040-4651) 1999 Arabidopsis cop8 and fus4 mutations define the same gene that encodes subunit 4 of the COP9 signalosome. Arabidopsis cop8 and fus4 mutations define the same gene that encodes subunit 4 of the COP9 signalosome. Plant Cell (1040-4651) 1999 Serino G., Tsuge T., Kwok S., Matsui M., Wei N., Deng XW. revisit when wei reference is avaliable - ordered through paperbase in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Serino G., Tsuge T., Kwok S., Matsui M., Wei N., Deng XW. revisit when wei reference is avaliable - ordered through paperbase Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant Cell (1040-4651) 1999 csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH D182ABACE4238759 csn5a_braol COP9 signalosome complex subunit 5a Jun activation domain-binding homolog 2 CSN5A AJH2 protein protein braol Brassica oleracea (Wild cabbage) Wild cabbage KNILTVEQPDSSSSDGIFYYDEASKRVQISALAL 0531998D0B7B9893 csn7_braol COP9 signalosome complex subunit 7 FUSCA protein 5 CSN7 FUS5 protein protein braol Brassica oleracea (Wild cabbage) Wild cabbage QAEIIDQLVRLFAHGTWGDYKCNASRIPQLSPDQILKQLTVLTLAESNKKWADNMSEIDKKEAEEGVEELK 44BCF8AE033D1A4F csn6b_braol COP9 signalosome complex subunit 6b CSN6B protein protein braol Brassica oleracea (Wild cabbage) Wild cabbage KLHPLVMLNISDHLTKALMDINESPVYVLLNPTINHAQKKMLNSRIRVLHQYLGSMQK B7B203190B57E9FE csn2_braol COP9 signalosome complex subunit 2 FUSCA protein 12 CSN2 FUS12 protein protein braol Brassica oleracea (Wild cabbage) Wild cabbage KSAVTRNYSEKKNERLWFKKNYDHAGNQRRIQKWNTQLK BD38114BA373C1CB csn3_braol COP9 signalosome complex subunit 3 FUSCA protein 11 CSN3 FUS11 protein protein braol Brassica oleracea (Wild cabbage) Wild cabbage KSIQGLSASPGDLSALHGKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYK 0521F7EE9B87CD50 csn1_arath COP9 signalosome complex subunit 1 Constitutive photomorphogenesis protein 11 Protein FUSCA 6 CSN1 COP11 FUS6 At3g61140 T20K12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL C2A980E744B23A90 csn4_braol COP9 signalosome complex subunit 4 Constitutive photomorphogenesis protein 8 FUSCA protein 4 CSN4 COP8 FUS4 protein protein braol Brassica oleracea (Wild cabbage) Wild cabbage KRKFLDAALRYYSISQIEKKAYLPDKSTVLDRAMIEHNNLLSASK B29A75E629404959 csn8-csn7 2 7 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage 10 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage physical association physical association cop9-cop8 2 10 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage 6 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage 8 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage 7 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage 5 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage 4 unspecified role unspecified role neutral component neutral component braol Brassica oleracea (Wild cabbage) Wild cabbage association association Authors detected a protein homologous to the arabidopsis COP9 signalosome complex subunit 5b (UniProt accession number: Q8LAZ7) present within the cauliflower COP9 complex Authors detected COP9 signalosome complex subunit 1 (UniProt accession number: P68352) as part of the COP9 signalsome complex using biochemical purification methods (data not shown in paper) csn4-csn5 1 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association csn4-csn8 1 3 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association csn4-csn1 1 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association csn4-csn7 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association csn5-csn4 1 10 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association csn7-csn4 1 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association csn8-csn4 1 10 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association