IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol. (0032-0889) 1999 Moon YH., Kang HG., Jung JY., Jeon JS., Sung SK., An G. Table 1. genean@postech.ac.kr A cDNA library of rice panicles was used in this study. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Moon YH., Kang HG., Jung JY., Jeon JS., Sung SK., An G. Directed yeast two hybrid assay used in this experiment. Table 1. genean@postech.ac.kr Annotation to indicate that this entry has been checked and accepted by a senior curator. Annotation to indicate that this entry has been checked and accepted by a senior curator. A cDNA library of rice panicles was used in this study. Plant Physiol. (0032-0889) 1999 Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol. (0032-0889) 1999 Moon YH., Kang HG., Jung JY., Jeon JS., Sung SK., An G. Table 1. genean@postech.ac.kr A cDNA library of rice panicles was used in this study. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moon YH., Kang HG., Jung JY., Jeon JS., Sung SK., An G. Table 1. genean@postech.ac.kr Annotation to indicate that this entry has been checked and accepted by a senior curator. Annotation to indicate that this entry has been checked and accepted by a senior curator. A cDNA library of rice panicles was used in this study. Plant Physiol. (0032-0889) 1999 mad18_orysj MADS-box transcription factor 18 MADS18 MADS2 MADS28 FDRMADS7 MADS-box protein 2 MADS-box protein 28 OsMADS18 OsMADS2 OsMADS28 OSJNBb0040H10.26 OsJ_25046 LOC_Os07g41370 Os07g0605200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSHSSMEGILERYQRYSFDERAVLEPNTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEKEKNNAIINTNREEQNGATPSTSSPTPVTAPDPIPTTNNSQSQPRGSGESEAQPSPAQAGNSKLPPWMLRTSHT 9B78618813BF0C08 mads7_orysj MADS-box transcription factor 7 MADS7 AGL6 FDRMADS1 M79 MADS-box protein 45 MADS45 OsMADS45 OsMADS7 Protein AGAMOUS-like 6 RMADS216 P0702E04.10 LOC_Os08g41950 Os08g0531700 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGYPAEHHEAMNSACMNTYMPPWLP F50ACEEBC4ABDD08 mads1_orysj MADS-box transcription factor 1 MADS1 LHS1 OsMADS1 Protein LEAFY HULL STERILE 1 Protein SEPALLATA-like OsJ_09913 LOC_Os03g11614 Os03g0215400 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEINYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHSLQIGYHHPHAHHHQAYMDHLSNEAADMVAHHPNEHIPSGWI 70A3DAEED355A37C mad17_orysj MADS-box transcription factor 17 MADS17 NMADS3 OsMADS17 RMADS213 OSJNBa0064M23.11 Os04g0580700 LOC_Os04g49150 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGINKTLEKYNSCCYNAQGSNSALAGGEHQSWYQEMSRLKTKLECLQRSQRHMLGEDLGPLSIKELQQLEKQLEYSLSQARQRKTQIMMEQVDDLRRKERQLGELNKQLKNKLEAEADSSNCRSAIQDSWVHGTVVSGGRVLNAQPPPDIDCEPTLQIGYYQFVRPEAANPRSNGGGGDQNNNFVMGWPL D4D5D46FD2881B4B mads6_orysj MADS-box transcription factor 6 MADS6 MFO1 OsMADS6 Protein MOSAIC FLORAL ORGANS 1 OJ1123_G04.6 OsJ_07942 Os02g0682200 LOC_Os02g45770 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGITKTLERYQHCCYNAQDSNNALSETQSWYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKHKLEVEGSTSNYRAMQQASWAQGAVVENGAAYVQPPPHSAAMDSEPTLQIGYPHQFVPAEANTIQRSTAPAGAENNFMLGWVL 7E574BD86A48220C mads8_orysj MADS-box transcription factor 8 MADS8 OsMADS8 MADS-box protein 24 OsMADS24 MADS24 OsJ_29947 LOC_Os09g32948 Os09g0507200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGQSMTRTLERYQKFSYGGPDTAIQNKENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEESNQLHGQVWEHGATLLGYERQSPHAVQQVPPHGGNGFFHSLEAAAEPTLQIGFTPEQMNNSCVTAFMPTWLP 201E889194CEC585 mads5_orysj MADS-box transcription factor 5 MADS5 FDRMADS2 OsMADS5 OsJ_019405 P0681F10.39 LOC_Os06g06750 Os06g0162800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTLERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHISCQDVGPSGHASEANQEFLHHAICDPSLHIGYQAYMDHLNQ 77BE937D9DE6E78A mad14_orysj MADS-box transcription factor 14 MADS14 AGL10 FDRMADS6 OsMADS14 Protein AGAMOUS-like 10 Protein APETALA1-like B RAP1B RMADS211 OJ1112_G08.13 OSJNBa0032E21.04 OSJNBa0047E24.2 OsJ_12598 LOC_Os03g54160 Os03g0752800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYATDSCMDKILERYERYSYAEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQTQPQTSSSSSSFMMREALPTTNISNYPAAAGERIEDVAAGQPQHVRIGLPPWMLSHING 80CF6A3CAFB4084C mad15_orysj MADS-box transcription factor 15 MADS15 RAP1A FDRMADS3 OsMADS15 Protein APETALA1-like A RMADS215 OJ1567_G09.109-1 P0585H11.124-1 Os07g0108900 LOC_Os07g01820 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATDSRMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELVERQKNVRGQQQVGQWDQTQVQAQAQAQPQAQTSSSSSSMLRDQQALLPPQNICYPPVMMGERNDAAAAAAVAAQGQVQLRIGGLPPWMLSHLNA 5A31330C64180D92 mads1-osmads6 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association osmads6-osmads5 2 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-mads1 2 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association osmads6-osmads7 2 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-osmads14 2 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-osmads15 2 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association osmads6-osmads17 2 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association osmads6-osmads18 2 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association osmads6-mads1-1 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-osmads5-1 1 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-osmads7-1 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-osmads8 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association osmads6-osmads14-1 1 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q6EU39:p.[Leu110Arg;Leu118Arg;Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Fri Jul 22 11:05:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110ser,leu118arg,leu159arg,leu166arg' Wed May 02 16:38:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110arg,leu118arg,leu159arg,leu166arg' Tue Jun 30 18:57:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu110Arg;Leu118Arg;Leu159Arg;Leu166Arg]' Q6EU39:p.[Leu110Ser;Leu118Arg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain L R Wed May 02 20:05:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110ser,leu118arg' Tue Jun 30 15:41:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu110Ser;Leu118Arg]' Q6EU39:p.[Leu126Arg;Leu134Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Fri Jul 22 11:07:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu126arg, leu134arg' Wed May 02 19:19:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu126arg,leu134arg' Tue Jun 30 19:26:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu126Arg;Leu134Arg]' Q6EU39:p.[Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Wed May 02 19:26:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu159arg,leu166arg' Tue Jun 30 18:54:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu159Arg;Leu166Arg]' physical association physical association osmads6-osmads15-1 1 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association MADS15 construct contains K domain and C region of the protein, range not given in text. osmads6-osmads17-1 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association The OSMADS17 protein contained the K domain and C region of the protein, range not given in text. osmads6-osmads18-1 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association The OSMADS18 protein contained the K domain and C terminal region, range not given in text. osmads14-osmads6 1 10 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q6EU39:p.[Leu110Arg;Leu118Arg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Fri Jul 22 11:12:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110ser,leu118arg' Wed May 02 17:41:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110arg,leu118arg' Tue Jun 30 16:00:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu110Arg;Leu118Arg]' Q6EU39:p.[Leu126Arg;Leu134Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Fri Jul 22 10:52:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu126arg, leu134arg' Wed May 02 18:02:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu126arg,leu134arg' Tue Jun 30 18:04:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu126Arg;Leu134Arg]' Q6EU39:p.[Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Wed May 02 17:22:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu159arg,leu166arg' Tue Jun 30 19:25:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu159Arg;Leu166Arg]' Q6EU39:p.[Leu110Arg;Leu118Arg;Leu159Arg;Leu166Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain L R Fri Jul 22 10:58:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110ser,leu118arg,leu159arg,leu166arg' Wed May 02 17:05:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110arg,leu118arg,leu159arg,leu166arg' Tue Jun 30 20:04:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu110Arg;Leu118Arg;Leu159Arg;Leu166Arg]' physical association physical association