IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. J. Biol. Chem. (0021-9258) 1999 Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. Annotation to indicate that this entry has been checked and accepted by a senior curator. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. J. Biol. Chem. (0021-9258) 1999 Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. Annotation to indicate that this entry has been checked and accepted by a senior curator. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. J. Biol. Chem. (0021-9258) 1999 Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. Annotation to indicate that this entry has been checked and accepted by a senior curator. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. J. Biol. Chem. (0021-9258) 1999 Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. Annotation to indicate that this entry has been checked and accepted by a senior curator. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. Cloning and characterization of ATRAP, a novel protein that interacts with the angiotensin II type 1 receptor. J. Biol. Chem. (0021-9258) 1999 Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. cDNA library from mouse kidney poly(A)+ RNA. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging sequence tag sequence tag identification sequence tag Daviet L., Lehtonen JY., Tamura K., Griese DP., Horiuchi M., Dzau VJ. Table 1. Annotation to indicate that this entry has been checked and accepted by a senior curator. cDNA library from mouse kidney poly(A)+ RNA. J. Biol. Chem. (0021-9258) 1999 atrap_mouse Type-1 angiotensin II receptor-associated protein AT1 receptor-associated protein Agtrap Atrap protein protein mouse Mus musculus Mouse MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGGLVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLRPDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAVPRGY 42094CBD40A2F97C agtra_mouse Type-1A angiotensin II receptor Angiotensin II type-1A receptor Agtr1a Agtr1 protein protein mouse Mus musculus Mouse MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVCAFHYESRNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAKKPASCSEVE 966958A738D8F53E agtr1-agtrap-1 1 7 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-765198]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 360-360, sequence length 359 [EBI-765198]298-360 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association agtr1-agtrap-2 2 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-765211]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 360-360, sequence length 359 [EBI-765211]298-360 ecoli Escherichia coli (strain K12) physical association physical association agtr1-agtrap-3 3 6 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 7 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association No significant difference was observed in the amount of ATRAP co-immunoprecipitated with the AT1 receptor before or after Ang II stimulation. agtr1-agtrap-4 5 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 6 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization agtr1-agtrap-5 4 7 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association The levels of beta-galactosidase expression were qualified. Interactions with AT-1A(297-359AA) and ATRAP produced a beta-gal measurement of 160 beta-gal units, whereas, AT-1A (297-349AA) produced a beta-gal measurement of 60 beta gal units. AT-1A which was truncated to 297-339AA or less (297-329AA) did not interact with ATRAP.