MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells. PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells. EMBO J. (0261-4189) 1999 Perego C., Vanoni C., Villa A., Longhi R., Kaech SM., Fröhli E., Hajnal A., Kim SK., Pietrini G. no canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Perego C., Vanoni C., Villa A., Longhi R., Kaech SM., Fröhli E., Hajnal A., Kim SK., Pietrini G. no EMBO J. (0261-4189) 1999 PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells. PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells. EMBO J. (0261-4189) 1999 Perego C., Vanoni C., Villa A., Longhi R., Kaech SM., Fröhli E., Hajnal A., Kim SK., Pietrini G. no in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Perego C., Vanoni C., Villa A., Longhi R., Kaech SM., Fröhli E., Hajnal A., Kim SK., Pietrini G. no EMBO J. (0261-4189) 1999 PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells. PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells. EMBO J. (0261-4189) 1999 Perego C., Vanoni C., Villa A., Longhi R., Kaech SM., Fröhli E., Hajnal A., Kim SK., Pietrini G. no canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Perego C., Vanoni C., Villa A., Longhi R., Kaech SM., Fröhli E., Hajnal A., Kim SK., Pietrini G. no EMBO J. (0261-4189) 1999 s6a12_canlf Sodium- and chloride-dependent betaine transporter SLC6A12 Na(+)/Cl(-) betaine/GABA transporter Solute carrier family 6 member 12 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MDRKVAVPEDGPPVVSWLPEEGEKLDQEGEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFTCGIPVFFLEVALGQYTSQGSVTAWRKICPLLQGIGLASVVIESYLNIYYIIILAWALFYLFSSFTSELPWTTCTNTWNTEHCMDFLNHSGARTATSSENFTSPVMEFWERRVLGITSGIHDLGALRWELALCLLLAWLICYFCIWKGVKTTGKVVYFTATFPYLMLVILLIRGITLPGAYQGVIYYLKPDLLRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYRDSIALCFLNSATSFAAGFVVFSILGFMAQEQGLPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASMDMFPSQLRKSGRRELLILAIAVFCYLAGLFLVTEGGMYIFQLFDYYASSGICLLFLAMFEVICISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSQYTPLKYNNIYVYPPWGYSIGWFLALSSMICVPLFVIITLLKTRGSFKKRLRQLTTPDPSLPQPKQHLYLDGGTSQDCGPSPTKEGLIVGEKETHL mint Transports betaine and GABA. May have a role in regulation of GABAergic transmission in the brain through the reuptake of GABA into presynaptic terminals, as well as in osmotic regulation B19A9589843183CC lin7a_mouse Protein lin-7 homolog A Mammalian lin-seven protein 1 Vertebrate lin-7 homolog 1 Lin7a Mals1 Veli1 protein protein mouse Mus musculus Mouse MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQPQQNHMS D8D05EF16A93B8BB lin7a-slc6a12 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-366861: original sequence: 609-614 : SPTKEGLIVGEKETH Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-366852: original sequence: 108-190 : VVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYT Stoichiometry: 1.0 physical association physical association F1B PDZ the authors also used Lin-7 from C. elegans homomint mint lin7a-slc6a12-1 3 4 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-366883: original sequence: 609-614 : SPTKEGLIVGEKETH Stoichiometry: 1.0 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-366875: original sequence: 108-190 : VVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYT Stoichiometry: 1.0 colocalization colocalization PDZ The LIN7-mediated interaction is responsable for the cell surface stability of wild-type BGT F4 F5 F6 homomint mint slc6a12-lin7a 1 4 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-366905: original sequence: 609-614 : SPTKEGLIVGEKETH Stoichiometry: 1.0 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-366898: original sequence: 108-190 : VVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYT Stoichiometry: 1.0 physical association physical association F1D PDZ homomint mint