IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). J. Biol. Chem. (0021-9258) 1999 Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D J. Biol. Chem. (0021-9258) 1999 The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). J. Biol. Chem. (0021-9258) 1999 Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D J. Biol. Chem. (0021-9258) 1999 The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). J. Biol. Chem. (0021-9258) 1999 Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay predetermined predetermined participant predetermined Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D J. Biol. Chem. (0021-9258) 1999 The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). J. Biol. Chem. (0021-9258) 1999 Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D J. Biol. Chem. (0021-9258) 1999 The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). J. Biol. Chem. (0021-9258) 1999 Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom monoclonal western monoclonal antibody western blot monoclonal western Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D J. Biol. Chem. (0021-9258) 1999 The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs). J. Biol. Chem. (0021-9258) 1999 Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Koizumi J., Okamoto Y., Onogi H., Mayeda A., Krainer AR., Hagiwara M. Bait protein incubated with HeLa cell extract. 1D J. Biol. Chem. (0021-9258) 1999 srpk2_mouse SRSF protein kinase 2 Serine/arginine-rich protein-specific kinase 2 SFRS protein kinase 2 Srpk2 protein protein mouse Mus musculus Mouse MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPLPDPAPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERKILEENITSAEASGEQDGEYQPEVTLKAADLEDTTEEETAKDNGEVEDQEEKEDAEKENAEKDEDDVEQELANLDPTWVESPKANGHIENGPFSLEQQLEDEEDDEDDCANPEEYNLDEPNAESDYTYSSSYEQFNGELPNGQHKTSEFPTPLFSGPLEPVACGSVISEGSPLTEQEESSPSHDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS 1857EA955B2F9C0E srsf1_human Serine/arginine-rich splicing factor 1 SF2 SF2P33 OK/SW-cl.3 SRSF1 ASF pre-mRNA-splicing factor SF2, P33 subunit Alternative-splicing factor 1 SFRS1 Splicing factor, arginine/serine-rich 1 protein protein human Homo sapiens Human MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT DIP protein Q07955 original sequence version: 191 DIP protein Q07955 original sequence version: 160 C28A0B2F112EA713 srpk1_human SRSF protein kinase 1 Serine/arginine-rich protein-specific kinase 1 SFRS protein kinase 1 SRPK1 protein protein human Homo sapiens Human MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS DIP protein Q96SB4 original sequence version: 128 900E980FE1C16B9A srpk1_mouse SRSF protein kinase 1 Serine/arginine-rich protein-specific kinase 1 SFRS protein kinase 1 Srpk1 protein protein mouse Mus musculus Mouse MERKVLALQARKKRTKAKKDKAQRKPETQHRGSAPHSESDIPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQKRPNKQEESESPVDRPLTENPPNKMTQEKLEESNSIGQDQTLTERGGEGGAPEINCNGVIGVVNYPENSNNETLRHKEDLHNANDCDVHTLKQEPSFLNSSNGDSSPSQDTDSCTPTASETMVCQSSAEQSLTRQDITQLEESIRADTPSGDEQEPNGALDSKGKFSAGNFLINPLEPKNAEKLQVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLLEVLVEKYEWPQEEAAGFTDFLLPMLELMPEKRATAAECLRHPWLNS CB779C163A11ECEB srpk1-sfrs1-1 5 9 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association srpk1-sfrs1-2 6 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association srpk2-sfrs1-1 4 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Phosphorylation of SFRS1 srpk1-sfrs1-3 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association srpk2-sfrs1-2 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association srpk2-sfrs1-3 4 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Phosphorylation of SFRS1 srpk1-sfrs1-4 4 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Phosphorylation of SFRS1 srpk1-sfrs1-6 1 10 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-593420]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 249-249, sequence length 248 [EBI-593420]205-249 ecoli Escherichia coli (strain K12) physical association physical association srpk1-sfrs1-7 3 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-593434]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 249-249, sequence length 248 [EBI-593434]205-249 ecoli Escherichia coli (strain K12) 10 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Phosphorylation of SFRS1 at Ser-226, Ser-233 and Ser-237 srpk1-sfrs1-8 1 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association