MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure at 1.95 A resolution of the breast tumour-specific antibody SM3 complexed with its peptide epitope reveals novel hypervariable loop recognition. Crystal structure at 1.95 A resolution of the breast tumour-specific antibody SM3 complexed with its peptide epitope reveals novel hypervariable loop recognition. J. Mol. Biol. (0022-2836) 1998 Dokurno P., Bates PA., Band HA., Stewart LM., Lally JM., Burchell JM., Taylor-Papadimitriou J., Snary D., Sternberg MJ., Freemont PS. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dokurno P., Bates PA., Band HA., Stewart LM., Lally JM., Burchell JM., Taylor-Papadimitriou J., Snary D., Sternberg MJ., Freemont PS. no J. Mol. Biol. (0022-2836) 1998 hvm32_mouse Ig heavy chain V-III region J606 protein protein mouse Mus musculus Mouse EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTTGFAYWGQGTLVTVSA mint B67AD6638A121A5F lv1e_mouse Ig lambda-1 chain V region S43 protein protein mouse Mus musculus Mouse MAWISLILSLLALSSGAISQAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGTQTEDEAMYFCALWYSNHWVFGGGTKLTVLG mint 84E54E7DD5791345 hvm32-lv1e 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction In the xray complex 1sm3, P01801 is chain H and P01727 is chain L Resolution 1.950 mint