IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction between Cdc37 and Cdk4 in human cells. Interaction between Cdc37 and Cdk4 in human cells. Oncogene (0950-9232) 1997 Lamphere L., Fiore F., Xu X., Brizuela L., Keezer S., Sardet C., Draetta GF., Gyuris J. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lamphere L., Fiore F., Xu X., Brizuela L., Keezer S., Sardet C., Draetta GF., Gyuris J. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Oncogene (0950-9232) 1997 Interaction between Cdc37 and Cdk4 in human cells. Interaction between Cdc37 and Cdk4 in human cells. Oncogene (0950-9232) 1997 Lamphere L., Fiore F., Xu X., Brizuela L., Keezer S., Sardet C., Draetta GF., Gyuris J. in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Lamphere L., Fiore F., Xu X., Brizuela L., Keezer S., Sardet C., Draetta GF., Gyuris J. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Oncogene (0950-9232) 1997 Interaction between Cdc37 and Cdk4 in human cells. Interaction between Cdc37 and Cdk4 in human cells. Oncogene (0950-9232) 1997 Lamphere L., Fiore F., Xu X., Brizuela L., Keezer S., Sardet C., Draetta GF., Gyuris J. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lamphere L., Fiore F., Xu X., Brizuela L., Keezer S., Sardet C., Draetta GF., Gyuris J. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Oncogene (0950-9232) 1997 cdc37_human Hsp90 co-chaperone Cdc37 CDC37 Hsp90 chaperone protein kinase-targeting subunit p50Cdc37 CDC37A protein protein human Homo sapiens Human MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV DIP protein Q16543 original sequence version: 156 55BFEFFF3C2A5442 cdk6_human Cyclin-dependent kinase 6 CDK6 Serine/threonine-protein kinase PLSTIRE Cell division protein kinase 6 CDKN6 protein protein human Homo sapiens Human MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA 571733EE6BE7FD4A cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE DIP protein P11802 original sequence version: 177 DIP protein P11802 original sequence version: 135 DIP protein P11802 original sequence version: 136 DIP protein P11802 original sequence version: 200 DIP protein P11802 original sequence version: 86 0916A0C07403A33A cdc37-cdk4 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association cdk4-cdc37 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association cdk6-cdc37 3 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association cdk6-cdc37-1 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association CDK6 35-S methionine labelled - interaction confirmed by autoradiography cdk4-cdc37-1 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association