IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mouse brain cDNA Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 biochemical biochemical western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding. Mol. Cell (1097-2765) 2004 Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. biochemical biochemical western blot western blot Immuno blot Immuno blot Lee BH., Min X., Heise CJ., Xu BE., Chen S., Shu H., Luby-Phelps K., Goldsmith EJ., Cobb MH. Synapse - Interactions of proteins with an established role in the presynapse. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 syt9_rat Synaptotagmin-9 Syt9 Syt5 Synaptotagmin IX Synaptotagmin V Synaptotagmin 5 protein protein rat Rattus norvegicus (Rat) Rat MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLLEKR 06A12B37A08240E5 wnk1_rat Serine/threonine-protein kinase WNK1 Wnk1 Prkwnk1 Protein kinase with no lysine 1 Protein kinase lysine-deficient 1 Hsn2 protein protein rat Rattus norvegicus (Rat) Rat MSDGTAEKQSGTPGFLSPPAPVPKNGSSSDSSVGEKLGAAVADSGIGRTEEYRRRRHTMDKDSRGAAATTTPTEHRFFRRSVICDSNATALELPGLPLSIPQPSVPAVVPQSAPPEPHREETLTATVASQVSQQPSAAASPGEQAVVGSATATVPSSTSKDRPVSQPSLVGSKEEPPPSRSGSGSGGASAKEPQEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKRKQEESSFKQQNEQQASVSQAGIQPLSVASTGIPTAPTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSIGTAPGHTVSSIQAQSQPHGVYPPSSMAQGQNQGQPSSSLAGVLSSQPVQHPQQQGIQPTVPPQQAVQYSLPQAASSSEGTVQPVSQPQVSAGTQSSTQGVSQAAPPEQTPITQSQPTQPVPLVSSVDSAHSDVASGMSDGNENAPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVAQVREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDYGFPGSQKLEGEFKQPIAVSSMPQQIGVPTSSLTQVVHSAGRRFIVSPVPESRLRESKIFTSEIPDPVAASTSQGPGMNLSHSASSLSLQQAFSELKHGQMTEGPNTAPPNFNHPGPTFSPFLTSIAGVQTVAASTPSVSVPITSSPLNDISTSVMQSEGALPTDKGIGGVTTSTGVVASGGLTTLSVSETPTLSSAVSSSTAPAVVTVSTTSQPVQASTSGSIASSTGSFPSGTFSTTTGTTVSSVAVPNAKPPTVLLQQVAGNTAGVAIVTSVSTTTPFPAMASQPSLPLGSSTSAPTLAETVVVSAHSLDKASHSSTAGLGLSFCAPSSSSSSGTAVSSSVSQPGIVHPLVISSAIASTPVLPQPAVPTSTPLLPQVPNIPPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHCPEMDADTQSKAPGIDDIKTLEEKLRSLFSEHSSSGTQHASVSLETPLVVETVTPGIPTTAVAPSKLMTSTTSTCLPPTNLPLGTAGMPVMPVGTPGQVSTPGTHASAPASTATGAKPGTTPPKPSLTKTVVPPVGTELSAGTVPCEQLPPFPGPSLIQTQQPLEDLDAQLRRTLSPETIPVTPAVGPLSTMSSTAVTEAGSQPQKDGTEVHVTASSSGAGVVKMGRFQVSVTMDDAQKERKNRSEDTKSVHFESSTSESSVLSSSSPESTLVKPEPNGITVSGISLDVPDSTHRTPTPEAKSETGQPTKVGRFQVTTTANKVGRFSVSRTEDKVTELKKEGPVTSPFRDSEQTVIPAAIPKKEKPELAEPSHLNGPSSDLEAAFLSRGGEDGSGSPHSPPHLCSKSLPIQTLSQSLSNSFNSSYMSSDNESDIEDEDLRLELRRLREKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSGTSVLNPQQTLHPPGNTPETGHNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGGTVSSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNMGGSTPISAASATSLGHFTKSMCPPQQYGFPAAPFGTQWSGTGGPAPQPLGQFQPVGTTSLQNFNISNLQKSISNPPGSNLRTT 89AC72F9CC8B07DF syt9_mouse Synaptotagmin-9 Syt9 Syt5 Synaptotagmin IX Synaptotagmin V protein protein mouse Mus musculus Mouse MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQENCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLMEKR E08ECFD9F4D6EE14 syt2_rat Synaptotagmin-2 Syt2 Synaptotagmin II protein protein rat Rattus norvegicus (Rat) Rat MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P29101 original sequence version: 109 D852AF5387E0C7FD syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21707 original sequence version: 71 DIP protein P21707 original sequence version: 76 DIP protein P21707 original sequence version: 141 DIP protein P21707 original sequence version: 112 DIP protein P21707 original sequence version: 145 DIP protein P21707 original sequence version: 160 06CE28F04C97A722 wnk1_human Serine/threonine-protein kinase WNK1 WNK1 KDP KIAA0344 PRKWNK1 Protein kinase with no lysine 1 Protein kinase lysine-deficient 1 Erythrocyte 65 kDa protein Kinase deficient protein HSN2 protein protein human Homo sapiens Human MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQGQPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAPQVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYPVSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLLQPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPGGSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQPTTLASSVDSAHSDVASGMSDGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIVSPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPNTAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTEEGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEIVVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPSTASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSYISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLETSLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVSTTTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSDVPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSPHSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASVLHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGTGGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT DIP protein Q9H4A3 original sequence version: 148 DIP protein Q9H4A3-1 original sequence version: 112 426785F98A452A0A syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P46097 original sequence version: 113 DIP protein P46097 original sequence version: 117 B4BD13FF70E0481B syt3_mouse Synaptotagmin-3 Syt3 Synaptotagmin III protein protein mouse Mus musculus Mouse MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE 87EAEAADF22D5A4C prkwnk1-1 3 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-syt2-2 5 12 unspecified role unspecified role prey prey c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association binding is Ca 2+ sensitive (positive effect) prkwnk1-syt2-3 2 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association prkwnk1-syt2-4 2 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role prey prey ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association prkwnk1-syt2-5 6 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 14 unspecified role unspecified role prey prey physical association physical association prkwnk1-syt1-1 4 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait ser_thr_pkin_as kinase domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-syt2-6 4 10 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9JIH7:p.Val318Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Wed May 02 15:26:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val318asp' Tue Jun 30 16:58:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val318Asp' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey P29101:p.Asp231Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D S Wed May 02 19:14:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp231ser' Tue Jun 30 15:38:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp231Ser' c2a domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-syt2-7 4 10 unspecified role unspecified role bait bait Q9JIH7:p.Val318Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Wed May 02 15:25:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val318glu' Tue Jun 30 19:45:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val318Glu' ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey P29101:p.Asp310Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 18:11:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp310asn' Tue Jun 30 20:06:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp310Asn' c2b domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-syt2-8 4 10 unspecified role unspecified role bait bait Q9JIH7:p.Val318Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Wed May 02 18:11:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val318glu' Tue Jun 30 17:26:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val318Glu' ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey P29101:p.Asp310Asn D310N mutation prevents binding to WNK1 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:53:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp310asn' Tue Jun 30 19:48:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp310Asn' c2a_c2b domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-syt2-9 1 10 enzyme enzyme unspecified role unspecified role ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region possible phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation syt2 is phosphorylated on Thr202 and Thr386 as detected by mass spectrometry prkwnk1-syt2-10 8 12 enzyme target enzyme target substrate substrate unspecified role unspecified role c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 enzyme enzyme unspecified role unspecified role ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation Syt2 is phosphorylated in vivo as shown with 32P incorporation. prkwnk1-syt2-11 7 12 enzyme target enzyme target substrate substrate unspecified role unspecified role c2 domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 enzyme enzyme unspecified role unspecified role ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation in vivo syt2 phosphorylation T202 detected with an antibody anti-phospho-T202-syt2 prkwnk1-syt3-1 4 10 unspecified role unspecified role bait bait ser_thr_pkin_as kinase domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-syt9-1 4 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait ser_thr_pkin_as kinase domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association prkwnk1-12 3 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1A prkwnk1-13 3 10 unspecified role unspecified role bait bait ser_thr_pkin_as binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1A