IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mouse DESC1 is located within a cluster of seven DESC1-like genes and encodes a type II transmembrane serine protease that forms serpin inhibitory complexes. Mouse DESC1 is located within a cluster of seven DESC1-like genes and encodes a type II transmembrane serine protease that forms serpin inhibitory complexes. J. Biol. Chem. (0021-9258) 2004 Hobson JP., Netzel-Arnett S., Szabo R., Rehault SM., Church FC., Strickland DK., Lawrence DA., Antalis TM., Bugge TH. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hobson JP., Netzel-Arnett S., Szabo R., Rehault SM., Church FC., Strickland DK., Lawrence DA., Antalis TM., Bugge TH. J. Biol. Chem. (0021-9258) 2004 pai1_mouse Plasminogen activator inhibitor 1 Endothelial plasminogen activator inhibitor Serpine1 Mr1 Pai1 Planh1 Serpin E1 protein protein mouse Mus musculus Mouse MQMSSALACLILGLVLVSGKGFTLPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQRDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMINDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFNYTEFTTPDGLEYDVVELPYQRDTLSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPTEMVIDRSFLFVVRHNPTETILFMGQVMEP 765FF1659C70F68C ipsp_mouse Plasma serine protease inhibitor Serpin A5 Protein C inhibitor Plasminogen activator inhibitor 3 Serpina5 Pci protein protein mouse Mus musculus Mouse MRFFPILCLVLFISHGVASRRHSHSKKKKAKESSVGAVGPPSSKDFAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKLHKGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQINNYVAKQTKGKIVDFIKDLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMMNREDGYSYYLDQNISCTVVGIPYQGNAIALFILPSEGKMKQVEDGLDERTLRNWLKMFTKRRLDLYLPKFSIEATYKLENVLPKLGIQDVFTTHADLSGITDHTNIKLSEMVHKSMMEVEESGTTAAAITGAIFTFRSARPSSLKIEFTRPFLLTLMEDSHILFVGKVTRP 0E7377A3F8C1A464 tm11e_mouse Transmembrane protease serine 11E Serine protease DESC1 Desc1 Tmprss11e protein protein mouse Mus musculus Mouse MYRSCVVRARKRTCVEPWVIGIISFLSLIVLAVCIGLTVHYVRYNHRRTYNYYSTLSFTSDKLYSEFGREASKNFTEMSQRIETMVKHAFHKSPLRGQLVKAHIIKFSKEDDGVLAHMLLIFRIRSTEDPETVHKIIEYVLHEKLKYATGPPNVDPESVKIKKINKTESDNYFNHCCGTRRNKSTVQTSVRIVGGTPVEEEEWPWQSSLRWDGSHRCGATLINNTWLVTAAHCFRTHKDPSRWSATFGATLQPRKLTTGIRRIIVHEKYKYPSHDYDIALAELSKPVPCTNAVHKVCLPDANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQTCNQPQSYNGAITPRMLCAGFLKGEKDACQGDSGGPLVTADVRDIWYLAGVVSWGDECGQPNKPGVYTRVTAFRHWIASNTGI D71BF4F0283BB896 desc1-serpine1-1 1 2 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association desc1-serpina5-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association desc1-serpine1-2 1 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role prey prey P22777:p.Arg369Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:57:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg369ala' Tue Jun 30 15:58:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg369Ala' P22777:p.[Thr356Arg;Ala358Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T R certain certain sequence position certain certain certain sequence position certain A R Fri Jul 22 11:04:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr356arg-ala358arg' Wed May 02 16:25:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr356arg,ala358arg' Tue Jun 30 16:14:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr356Arg;Ala358Arg]' physical association physical association desc1-serpina5-2 1 3 unspecified role unspecified role prey prey P70458:p.Arg374Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:16:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg374ala' Tue Jun 30 17:08:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg374Ala' 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association