MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. FEBS Lett. (0014-5793) 2004 imex curation Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. FEBS Lett. (0014-5793) 2004 imex curation Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). cosedimentation cosedimentation predetermined predetermined participant predetermined Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. FEBS Lett. (0014-5793) 2004 imex curation Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. FEBS Lett. (0014-5793) 2004 imex curation Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. FEBS Lett. (0014-5793) 2004 imex curation Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity. FEBS Lett. (0014-5793) 2004 imex curation Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 cosedimentation cosedimentation predetermined predetermined participant predetermined Wang Y., Lu C., Wei H., Wang N., Chen X., Zhang L., Zhai Y., Zhu Y., Lu Y., He F. no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation csn2_human COP9 signalosome complex subunit 2 JAB1-containing signalosome subunit 2 Thyroid receptor-interacting protein 15 Alien homolog COPS2 CSN2 TRIP15 protein protein human Homo sapiens Human MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA DIP protein P61201 original sequence version: 67 DIP protein P61201-1 original sequence version: 106 DIP protein P61201 original sequence version: 122 DIP protein P61201-1 original sequence version: 76 1DB6FA774C13BC59 csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS DIP protein Q92905 original sequence version: 161 DIP protein Q92905 original sequence version: 87 DIP protein Q92905 original sequence version: 132 DIP protein Q92905 original sequence version: 149 DIP protein Q92905 original sequence version: 136 DIP protein Q92905 original sequence version: 101 B5742F4AAD03A1CF csn8_human COP9 signalosome complex subunit 8 COPS8 CSN8 JAB1-containing signalosome subunit 8 COP9 homolog protein protein human Homo sapiens Human MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN DIP protein Q99627 original sequence version: 79 DIP protein Q99627-1 original sequence version: 118 DIP protein Q99627 original sequence version: 135 203E236D8E304A8A alr_human FAD-linked sulfhydryl oxidase ALR Augmenter of liver regeneration GFER ALR HERV1 HPO Hepatopoietin protein protein human Homo sapiens Human MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 43CBF8CCB5BA91C8 csn1_human COP9 signalosome complex subunit 1 JAB1-containing signalosome subunit 1 G protein pathway suppressor 1 Protein MFH GPS1 COPS1 CSN1 protein protein human Homo sapiens Human MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM DIP protein Q13098 original sequence version: 97 DIP protein Q13098 original sequence version: 154 DIP protein Q13098 original sequence version: 134 BF925164ED985638 gfer-gps1 4 10 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 11 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F2 FEBS-Letters homomint mint cops2-gfer 4 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F2 FEBS-Letters homomint mint cops8-gfer 4 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F2 FEBS-Letters homomint mint cops5-gfer 4 10 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 8 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F2 FEBS-Letters homomint mint gfer-cops5 1 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B FEBS-Letters homomint mint gfer-cops8 1 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B FEBS-Letters homomint mint gfer-gps1-1 1 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B FEBS-Letters homomint mint gfer-cops2 5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1B FEBS-Letters homomint mint cops5-gfer-1 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A FEBS-Letters homomint mint cops8-gfer-1 3 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A FEBS-Letters homomint mint cops2-gfer-1 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A FEBS-Letters homomint mint gps1-gfer 3 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A FEBS-Letters homomint mint cops2-gfer-2 2 7 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F3B FEBS-Letters homomint mint gfer-gps1-2 2 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F3B FEBS-Letters homomint mint cops8-gfer-2 2 9 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F3B FEBS-Letters homomint mint cops5-gfer-2 6 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F3 FEBS-Letters homomint mint cops8-gfer-3 6 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F3A FEBS-Letters homomint mint cops2-gfer-3 6 7 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F3 FEBS-Letters homomint mint gfer-gps1-3 6 11 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F3A FEBS-Letters homomint mint