MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it HBZ interacts with JunD and stimulates its transcriptional activity. HBZ interacts with JunD and stimulates its transcriptional activity. FEBS Lett. (0014-5793) 2004 Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr accepted FEBS Lett. (0014-5793) 2004 HBZ interacts with JunD and stimulates its transcriptional activity. HBZ interacts with JunD and stimulates its transcriptional activity. FEBS Lett. (0014-5793) 2004 Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr accepted FEBS Lett. (0014-5793) 2004 HBZ interacts with JunD and stimulates its transcriptional activity. HBZ interacts with JunD and stimulates its transcriptional activity. FEBS Lett. (0014-5793) 2004 Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr accepted FEBS Lett. (0014-5793) 2004 HBZ interacts with JunD and stimulates its transcriptional activity. HBZ interacts with JunD and stimulates its transcriptional activity. FEBS Lett. (0014-5793) 2004 Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Thébault S., Basbous J., Hivin P., Devaux C., Mesnard JM. Virus - Publications including interactions involving viral proteins no sabine.thebault@univ-montpl.fr accepted FEBS Lett. (0014-5793) 2004 jund_human Transcription factor jun-D JUND protein protein human Homo sapiens Human METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY DIP protein P17535 original sequence version: 147 DIP protein P17535 original sequence version: 119 FE85A1AA2B5B9597 q7lyy4_9dela protein protein humt- Human T-lymphotropic virus 1 SDALDRWPVGRDDVGGPNIVPQRWGTSRLVHSLQTRRLGIRKEDSVQTLGSGLIISMVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGLLSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKEEEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQGAEKAKQHSARKEKMQELGIDGYTRQLEGEVESLEAERRKLLQEKEDLMGEVNYWQGRLEAMWLQ mint D02A727EC8D12E9C jund-q7lyy4 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F1A FEBS-Letters homomint mint q7lyy4-jund 4 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F1B FEBS-Letters homomint mint jund-q7lyy4-1 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F2 FEBS-Letters homomint mint jund-q7lyy4-2 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1174945: original sequence: 296-324 : LEEKVKTLKSQNTELASTASLLREQVAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1D FEBS-Letters homomint mint