IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions of GGA3 with the ubiquitin sorting machinery. Interactions of GGA3 with the ubiquitin sorting machinery. Nat. Cell Biol. (1465-7392) 2004 Puertollano R., Bonifacino JS. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Puertollano R., Bonifacino JS. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Cell Biol. (1465-7392) 2004 Interactions of GGA3 with the ubiquitin sorting machinery. Interactions of GGA3 with the ubiquitin sorting machinery. Nat. Cell Biol. (1465-7392) 2004 Puertollano R., Bonifacino JS. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Puertollano R., Bonifacino JS. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Cell Biol. (1465-7392) 2004 gga3_human ADP-ribosylation factor-binding protein GGA3 Golgi-localized, gamma ear-containing, ARF-binding protein 3 GGA3 KIAA0154 protein protein human Homo sapiens Human MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL DIP protein Q9NZ52 original sequence version: 134 4F80D6032239168C ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC 33011162F1C48BB1 ts101_human Tumor susceptibility gene 101 protein TSG101 ESCRT-I complex subunit TSG101 protein protein human Homo sapiens Human MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY ADD6912FC22DF162 gga3-ubc-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association mutation L276A within the GGA1-VHS-GAT fragment impairs the interaction with Ubiquitin. VHS-GAT fragment of GGA3 is used (1-313) mutation I44A in ubiquitin impairs the interaction with GGA1-VHS-GAT fragment. GGA3-VHS (1-146) and GGA3-GAT (147-313) fragments are not sufficient for interaction with Ubiquitin gga3-tsg101-1 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association VHS-GAT fragment of GGA3 is used (1-313) GGA3-VHS (1-146) and GGA3-GAT (147-313) fragments are not sufficient for interaction with TSG101 mutation L276A within the GGA3 VHS-GAT fragment impairs interaction with TSG101 gga3-ubc-2 2 3 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 4 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association endogenous GGA3 and expressed myc-GGA3 are pulled-down by Ubiquitin beads