IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. EMBO J. (0261-4189) 2004 imex curation Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Only protein-protein interactions drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2004 Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. EMBO J. (0261-4189) 2004 imex curation Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2004 imex curation Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. EMBO J. (0261-4189) 2004 imex curation Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2004 imex curation Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. EMBO J. (0261-4189) 2004 imex curation Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. pull down pull down western blot western blot Immuno blot Immuno blot Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2004 imex curation Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. EMBO J. (0261-4189) 2004 imex curation Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Only protein-protein interactions drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2004 imex curation Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. Drosophila Cup is an eIF4E-binding protein that functions in Smaug-mediated translational repression. EMBO J. (0261-4189) 2004 imex curation Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Nelson MR., Leidal AM., Smibert CA. c.smibert@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2004 imex curation o61380_drome eIF4G1 eIF-4G eIF4G eIF4G-RA Dmel\CG10811 EIF4G Eif4G deIF4G eIF4g p200 Dmel_CG10811 CG10811 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQQAIPTLPTQSDIDKAMQPHSAQNMYVSTGNNNSGNTRSNPQSGGIFRGPPSTPNAPRGASGGATRHVHVQPMYSQPLHQNMVLQQYTQYNPRQQTFPASHLQYAPAPMPYYQYQYVPTLQQQPPHTRSAVTVNTNVNVGNNLQPVQSGPNGPLPVPGASSSQIQLLTSTVQPGASTVMGVGGPGSTMGQVGVPPMVGVGVMTTSVQPQPVQVQPASRRRHQHRLQIIDPTTKKNILDDFDKTKSNTDNEFSDQVTSTNTPATVLSEGPIRIPQQESVGLNNLTSTSSQGSESRTNAPYIPIETTPISRTDVGPTPIVSAMTDAPSVEILPTPQRGRSKKIPIVSPKNVSESIVAPITDETDDAGSTPISRATEESMPPNQTHPNLLISDSSKHKQAVSNSEISKDAPTGLKEMHVAELESSVASENHPAGILDVNVNKSSQSLDFSADPEIDSIGAISPTSPNAVSPILHEVLDNTELSKKLENSTTERFKDSQSVEKPTHQELSLRNATDETEISAMALQDVNSLDNNQIEKTYPSKPKLNVDVSEDISSRESAIKSTSTKNTGVDVGLQSDSKPETTLNDKQDSTDLKVKVSAKISSIINYNEGQWSPNNPSGKKQYDREQLLQLREVKASRIQPEVKNVSILPQPNLMPSFIRNNNNNKRVQSMVGIIGNRSNESAGNYIGKQMSMSGVQSGGGRSSMKGMIHVNLSLNQDVKLSENENAWRPRVLNKSDGDSDAKSALEKDELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDMLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKWQTSRNEAPKTMGQIEKEAKNEQLSAQYFGTLSSTTPGGSQGGSGKRDDRGNSRYGESRSSSAYGGSHSQRGDNGNLRHQQQNNVGGNVSGGAGHSNGNNDENTWHVQTSKGSRSLAVDSNKLEGLSKLSDQNLETKKMGGLTQFIWISSDTTRLSSAPTPTPSNPFAVLSSLIDKNSNERDRDRSGPRNKGSYNKGSMERDRYDRGMHSRTGSSQGSRENSSSRGGQQGRTLLSSSVQKSTSHSKYTQQAPPTRHTVKAQSSVGSSNVNTGPLYRGSEQQTSATFSQTTRSVAPVAVFIEASETDLKLIKSVVSEIVDLSAASKEVTPGAVSCIKRVPEKLRCSFIYYILTDYLHLANVGKQYRRYLSIAVSQLIQQNYISADHLRLAYNEFTVYANDLIVDIPELWLYILQFAGPLIVKKILTISDLWNNNLKENSPSNVAKKFLKTYLIYCTQEVGPNFARNMWIKFNLKWSDFMPESEVADFIKFNRLEYVENESKSPVIDHRETPEKHVKNVIDHIEHLLKEGTTADCIIDYSNGNIMVVDKLFIRGLTETLSNFSIHYKDNSYKLESETFQKFCIPVLQRYIDSNEDHQLECLYTLQLLVHGLEHPRGLLSELIGELYDAFVIQKESLCKWRDSKDQSAGKGVAVKSLNPFFNSLLNDDAN 6BBA557A1ACE251A 7-methylguanosine 5'-diphosphate(1+) 7-methylguanosine 5'-diphosphate(1+) 7-methyl-GDP 7-methyl-GDP(1+) 7-methylguanosine diphosphate 7-methylguanosine diphosphate(1+) 7-methylguanosine 5'-(trihydrogen diphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) SBASPRRECYVBRF-KQYNXXCUSA-O SBASPRRECYVBRF-KQYNXXCUSA-O cup_drome Protein cup cup fs(2)cup Oskar ribonucleoprotein complex 147 kDa subunit CG11181 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQMAEAEQENGAGALKIATNAGATDRPAHQQLPLPVEDQQDEVLTPAEKGKFEYPPPPPPPTPVQAPLATKATALNASQEHDDDEANSEKWEDPCAPPPPPPLPTSAFLATGLGYLKLPAFKLKDALEKAITKLEANKRTLKASPESSRSIKNKNVVALEMLPRRSNPETIGDGSMLASTSTAVMLQTKKPAVIVEMERRCKIINLLAKQNQILESISGEAIPMHGPSKHLHEDEGLTLQVLSARASTPYTQPSSMLSCTAVSCDLEHDSPRKQVASKEAVPEQQSSQVQQKRPPSTGIHKPGSLRAPKAVRPTTAPVVSSKPVKSYTRSRLMDIRNGMFNALMHRSKESFVMPRIATCDDIELEGRLRRMNIWRTSDGTRFRTRSTTANLNMNNNNNNECMPAFFKNKNKPNLISDESIIQSQPPQPQTEFQDPAIVNQRRIGSGRLNHSKWGYNDEDYHSYHNGKSQHMEEVNSKNSKNMTVLQFFDNGEISSQPQRRPNTPVMGMSINRSENDTLHSNESSEDLSRANENYVKRVMSGFLVVSKPKSRDVEDRHHRRYRNQNEEPEWFSCGPTSRLDTIELCGFDEDEEKMLKEGNKNHGLGETERETSKQKMDHKYKWTHAEPMGRSKYMPKHDTNNNHNVENMNNVMATEHQQQKEEKRPGSGRSFQFDKFNQSQQNYESSSYVNHQQPPQTQPQQMQQQSNTNTNNSKFMSFFANEGNSSSSSLNEFFKQAINQGHGNNPEQPKSLGHIGQMPSVDQLEAKWRRNSLNNVGETANKQTDNFQKLIGSLSSAKPQSQAVGYDAISNFIMQQQQYQQQQQKQHLIIQQQQQHTAFLASLQLKAILGRADTQLLLLRLTKGEISKHGLLVQLANPRLTDMDREAITAVLQFTNTQQQQQQHKQQLDMLSSTVIASQLQNLHNLAIVQQTLAARQQPQHNPQTQAPHQLSQEDLQAHANVIMRNAVMKRKIEEQTSKLINGGAKHQAQQQYLNRGQQRQARPDANSNALLHALISGGGNNHASGYPMNGQPQKHHSNLRFGDNQNFQSFESNQPHFATQYKQQYQQSQQQHPHQQPQQLNSLHQNNAGAVNSFNKAQMQAQSAISMLPNSGDEFH 91274997F199EFD3 smg_drome Protein Smaug smg CG5263 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKYATGTDNAMTSGISGQTNNSNSASNEMQPTTSTPTAAHKEATSTATTTATYANGNPNSNANPSQSQPSNALFCEQVTTVTNLFEKWNDCERTVVMYALLKRLRYPSLKFLQYSIDSNLTQNLGTSQTNLSSVVIDINANNPVYLQNLLNAYKTFQPCDLLDAMSSSSSDKDSMPCYGSDFQITTSAQCDERKLYARKEDILHEVLNMLPLLKPGNEEAKLIYLTLIPVAVKDTMQQIVPTELVQQIFSYLLIHPAITSEDRRSLNIWLRHLEDHIQAAAAGLTNRSYFLQPSPQLVAGGSSTGSGSCSSSATSSSTASCSSVASSSLCPASGSRSSRTNDWQTIAPPSKQLQNKLAGDWRGNGGGSSSGSINPLCDNLNGITLNELASSQNSLGLSLEGSSSLVNGVVAGAGSMLGIAGGDDHDTSFSKNGTEILDFDPVTADMGEACSLASSSLCGRNGGNPVEDRSQPPPNLQQQLLQPPPYASILMGNVGDQFGEINRWSLDSKIAALKTRRSNSLTTQTISSCSSSSNSSVITVNDNCSNSTENLAQFANKPRSFSLSIEHQRGALMNSGSDTRLDEFKPNYIKFHTRNVGMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKGASHKLALCIDKLKERANILNRVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLMWILDRSIHNEAFMNHASQLKDLKFKLSKMKISMVPKMHHVKPAGVGPNNGNINKPRWNGKTRKCDTKNGSNDRINNRKNSNDMLNFSLNCLPHPLPHHSQQAPPPLPQFDYNGYGGGPSHQPQYKSSSYPSFMGNPQQQPPPPPSSKSHHHPQQMQQMLQQHNHFPALPQQTPPQSHRRSLNNLILVAGGPQQPQQLIFKPGQGVLTNNGSNDNLVLERNQQSQQQQQQRKLSGGVSSAEQQPKKTMAAVVMENLAKFDQHFTLF 6EBB615435F07190 7-methyl-gtp 7-methyl-GTP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) if4e_drome Eukaryotic translation initiation factor 4E1 eIF4E1 Eif4e eIF-4E eIF-4F 25 kDa subunit mRNA cap-binding protein CG4035 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL DIP protein P48598 original sequence version: 96 B844B2DD5738758E smg-cup 1 10 weight silver stain molecular weight estimation by silver staining weight silver stain ms participant Identification by mass spectrometry ms participant ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cup binding sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association Fig. 1a smg-cup-1 3 9 unspecified role unspecified role prey prey radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cup binding sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Fig. 1b cup-eif4e 3 12 unspecified role unspecified role prey prey radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P48598:p.Glu106Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:03:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu106ala' Tue Jun 30 19:29:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu106Ala' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined eif4e binding sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain eif4e binding sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9VMA3:p.Tyr327Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 17:18:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr327Ala' Q9VMA3:p.[Leu364Ala;Leu368Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:21:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly379ala,arg383ala' Tue Jun 30 17:50:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu364Ala;Leu368Ala]' physical association physical association Fig. 2 eif4e-cup 3 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1b 7_methyl_gtp-cup 4 8 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey Q9VMA3:p.[Leu364Ala;Leu368Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:09:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu364ala,leu368ala' Tue Jun 30 18:50:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu364Ala;Leu368Ala]' region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VMA3:p.Tyr327Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:24:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr327ala' Tue Jun 30 17:46:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr327Ala' 11 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3a Apparently, anti-eif4e also detects cup but didn't detect 2 of the 3 cup mutants acc to the blot. I am not sure how to capture this... cup-eif_4e-1 2 9 unspecified role unspecified role bait bait Q9VMA3:p.Tyr327Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 17:53:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr327Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VMA3:p.[Tyr327Ala;Leu364Ala;Leu368Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 17:56:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr327Ala;Leu364Ala;Leu368Ala]' radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role prey prey radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P48598:p.Glu106Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Wed May 02 20:16:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu106ala' Tue Jun 30 18:46:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu106Ala' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig. 3b cup-smg 3 12 unspecified role unspecified role prey prey radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 unspecified role unspecified role prey prey radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VMA3:p.[Tyr327Ala;Leu364Ala;Leu368Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 20:12:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr327Ala;Leu364Ala;Leu368Ala]' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 583-763 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4 smg-cup-2 5 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey physical association physical association Fig. 4 The addition of RNAse reduced the interaction of smaug with cup and eIF4E, respectively. cup-eif_4e-2 5 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 4 The addition of RNAse reduced the interaction of smaug with cup and eIF4E, respectively. eif_4e-cup 6 7 unspecified role unspecified role prey prey 434-804 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 9 competitor competitor competitor prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait cnbr-activated sepharose tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 6 eif_4e-cup-1 6 7 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey 434-804 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role bait bait cnbr-activated sepharose tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 6 7_methyl_gtp-cup-1 4 11 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey Q9VMA3:p.[Leu364Ala;Leu368Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:41:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu364ala,leu368ala' Tue Jun 30 17:35:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu364Ala;Leu368Ala]' region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9VMA3:p.Tyr327Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:42:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr327ala' Tue Jun 30 19:29:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr327Ala' 12 unspecified role unspecified role prey prey physical association physical association Fig. 3a Apparently, anti-eif4e also detects cup but didn't detect 2 of the 3 cup mutants acc to the blot. I am not sure how to capture this... eif_4e-cup-2 6 12 unspecified role unspecified role bait bait cnbr-activated sepharose tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey 434-804 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig. 6