IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor. Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor. Nature (0028-0836) 2003 Renault L., Guibert B., Cherfils J. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Renault L., Guibert B., Cherfils J. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2003 arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK DIP protein P84077 original sequence version: 122 DIP protein P84077 original sequence version: 56 DIP protein P84077 original sequence version: 89 AAC773D4A60186B6 cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP DIP protein Q99418 original sequence version: 131 DIP protein Q99418 original sequence version: 140 DIP protein Q99418-1 original sequence version: 125 DIP protein Q99418 original sequence version: 125 70441A58483BD0E1 arf1-pscd2-3 1 3 unspecified role unspecified role neutral component neutral component sec7 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q99418:p.[Phe190Tyr;Ala191Ser;Ser198Asp;Pro208Met] mutation mutation certain certain sequence position certain certain certain sequence position certain F Y certain certain sequence position certain certain certain sequence position certain A S certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain P M Wed May 02 14:47:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe190tyr,ala191ser,ser198asp,pro208met' Tue Jun 30 17:33:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe190Tyr;Ala191Ser;Ser198Asp;Pro208Met]' ecobb Escherichia coli (strain B / BL21) 2 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction The natural inhibitor Brefeldin A (BFA), GDP and Magnesium are bound to the complex ARNO is mutated : F190Y, A191S, S198D, P208M to confere BFA-sensitivity Human, bovin, mouse and rat ARF1 have the same sequence 1.86 working 17.9%, free 22.0% arf1-pscd2-4 1 3 unspecified role unspecified role neutral component neutral component sec7 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q99418:p.[Glu156Lys;Phe190Tyr;Ala191Ser;Ser198Asp;Pro208Met] mutation mutation certain certain sequence position certain certain certain sequence position certain F Y certain certain sequence position certain certain certain sequence position certain A S certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain P M certain certain sequence position certain certain certain sequence position certain E K Fri Jul 22 11:03:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe190tyr,ala191ser,ser198asp,pro208met,glu156lys' Wed May 02 14:57:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu156lys,phe190tyr,ala191ser,ser198asp,pro208met' Tue Jun 30 19:17:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu156Lys;Phe190Tyr;Ala191Ser;Ser198Asp;Pro208Met]' ecobb Escherichia coli (strain B / BL21) 2 unspecified role unspecified role neutral component neutral component full length binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 14 11 direct interaction direct interaction the natural inhibitor Brefeldin A (BFA), GDP and Magnesium are bound to the complex ARNO is mutated : E156K (catalytic glutamic finger mutated) ARNO is mutated : F190Y, A191S, S198D, P208M to confere BFA-sensitivity. working 15.9%, free 17.0% 1.46