MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The BTB protein MEL-26 is a substrate-specific adaptor of the CUL-3 ubiquitin-ligase. The BTB protein MEL-26 is a substrate-specific adaptor of the CUL-3 ubiquitin-ligase. Nature (0028-0836) 2003 Pintard L., Willis JH., Willems A., Johnson JL., Srayko M., Kurz T., Glaser S., Mains PE., Tyers M., Bowerman B., Peter M. no lionel.pintard@bc.biol.ethz.ch in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pintard L., Willis JH., Willems A., Johnson JL., Srayko M., Kurz T., Glaser S., Mains PE., Tyers M., Bowerman B., Peter M. no lionel.pintard@bc.biol.ethz.ch Nature (0028-0836) 2003 The BTB protein MEL-26 is a substrate-specific adaptor of the CUL-3 ubiquitin-ligase. The BTB protein MEL-26 is a substrate-specific adaptor of the CUL-3 ubiquitin-ligase. Nature (0028-0836) 2003 Pintard L., Willis JH., Willems A., Johnson JL., Srayko M., Kurz T., Glaser S., Mains PE., Tyers M., Bowerman B., Peter M. no lionel.pintard@bc.biol.ethz.ch in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Pintard L., Willis JH., Willems A., Johnson JL., Srayko M., Kurz T., Glaser S., Mains PE., Tyers M., Bowerman B., Peter M. no lionel.pintard@bc.biol.ethz.ch Nature (0028-0836) 2003 The BTB protein MEL-26 is a substrate-specific adaptor of the CUL-3 ubiquitin-ligase. The BTB protein MEL-26 is a substrate-specific adaptor of the CUL-3 ubiquitin-ligase. Nature (0028-0836) 2003 Pintard L., Willis JH., Willems A., Johnson JL., Srayko M., Kurz T., Glaser S., Mains PE., Tyers M., Bowerman B., Peter M. no lionel.pintard@bc.biol.ethz.ch in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pintard L., Willis JH., Willems A., Johnson JL., Srayko M., Kurz T., Glaser S., Mains PE., Tyers M., Bowerman B., Peter M. no lionel.pintard@bc.biol.ethz.ch Nature (0028-0836) 2003 ktna1_caeel Meiotic spindle formation protein mei-1 mei-1 Katanin p60 ATPase-containing subunit A1 p60 katanin T01G9.5 protein protein caeel Caenorhabditis elegans MNGDVQSVIRGYLERAQVAKTMSDAGRWNEAGDLLRQLMTDVKSCKISASNRDEHDARNTFLRALEANLKLVQQNVRDEDDLHEAMTRQSGSPEPPADPDVWSKPSPPLPSSSKFGATKKGVGAAGPRPREISKSTSSMSTNPADVKPANPTQGILPQNSAGDSFDASAYDAYIVQAVRGTMATNTENTMSLDDIIGMHDVKQVLHEAVTLPLLVPEFFQGLRSPWKAMVLAGPPGTGKTLIARAIASESSSTFFTVSSTDLSSKWRGDSEKIVRLLFELARFYAPSIIFIDEIDTLGGQRGNSGEHEASRRVKSEFLVQMDGSQNKFDSRRVFVLAATNIPWELDEALRRRFEKRIFIPLPDIDARKKLIEKSMEGTPKSDEINYDDLAARTEGFSGADVVSLCRTAAINVLRRYDTKSLRGGELTAAMESLKAELVRNIDFEAALQAVSPSAGPDTMLKCKEWCDSFGAM 167A3929E573CD59 cul3_caeel Cullin-3 cul-3 Y108G3AL.1 protein protein caeel Caenorhabditis elegans MSGRSGNGGQQKMRIRPFMATIDEQYVTQTWELLKRAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGERLYNGLKDVIQDHMASVRIRIIESMNSGSFLETVAESWADHTVAMVMIRDILMYMDRIYVAQNNHVLPVYNLGLDAYRTEILRQNGIGDRIRDALLELIKLDRKSNQINWHGIKNACDMLISLGIDSRTVYEDEFERPLLKETSDYYRDVCKNWLSGDNDACFYLAQVEIAMHDEASRASRYLDKMTEAKILQVMDDVMVAEHIQTIVYMQNGGVKFMLEHKKIEDLTRIFRIFKRIGDSVTVPGGGLKALLKAVSEYLNETGSNIVKNEDLLKNPVNFVNELLQLKDYFSSLLTTAFADDRDFKNRFQHDFETFLNSNRQSPEFVALYMDDMLRSGLKCVSDAEMDNKLDNVMILFRYLQEKDVFEKYFKQYLAKRLLLDKSCSDDVEKALLAKLKTECGCQFTQKLENMFRDKELWLTLATSFRDWREAQPTKMSIDISLRVLTAGVWPTVQCNPVVLPQELSVAYEMFTQYYTEKHTGRKLTINTLLGNADVKATFYPPPKASMSNEENGPGPSSSGESMKERKPEHKILQVNTHQMIILLQFNHHNRISCQQLMDELKIPERELKRNLQSLALGKASQRILVRKNKGKDAIDMSDEFAVNDNFQSKLTRVKVQMVTGKVESEPEIRETRQKVEDDRKLEVEAAIVRIMKARKKLNHNNLVAEVTQQLRHRFMPSPIIIKQRIETLIEREYLARDEHDHRAYQYIA 3D90A41092E540A7 mel26_caeel Protein maternal effect lethal 26 ZK858.4 mel-26 protein protein caeel Caenorhabditis elegans MEPRIDGGVFIGGIGNSGNEMCSNGVPALGVSSQTEIKVEKVQHTWTVKNFSHCYQEYLENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLCLNRVINNNVKAGKIGFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLFPQIMPRDMIIVNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILKGHPNLITDIFSQIDRQSSTGATSSVSNLPGVPMDIPGITGNIVPPPSGL 3AED944583A155AC mel_26-cul_3-1 2 Q94420 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 CUL3 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association mint cul_3-mel_26 2 Q94420 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 CUL3 5 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association mint cul_3-mel_26-1 3 CUL3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Q94420 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint mei_1-mel_26-6 3 MEI1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Q94420 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint mel_26-cul_3-2 1 CUL3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 Q94420 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction mint