IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of Pellino2, a substrate of IRAK1 and IRAK4. Characterization of Pellino2, a substrate of IRAK1 and IRAK4. FEBS Lett. (0014-5793) 2003 Strelow A., Kollewe C., Wesche H. Human HeLa Matchmaker cDNA Library (Clontech) yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Strelow A., Kollewe C., Wesche H. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Human HeLa Matchmaker cDNA Library (Clontech) FEBS Lett. (0014-5793) 2003 Characterization of Pellino2, a substrate of IRAK1 and IRAK4. Characterization of Pellino2, a substrate of IRAK1 and IRAK4. FEBS Lett. (0014-5793) 2003 Strelow A., Kollewe C., Wesche H. Human HeLa Matchmaker cDNA Library (Clontech) in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Strelow A., Kollewe C., Wesche H. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Human HeLa Matchmaker cDNA Library (Clontech) FEBS Lett. (0014-5793) 2003 Characterization of Pellino2, a substrate of IRAK1 and IRAK4. Characterization of Pellino2, a substrate of IRAK1 and IRAK4. FEBS Lett. (0014-5793) 2003 Strelow A., Kollewe C., Wesche H. Human HeLa Matchmaker cDNA Library (Clontech) human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Strelow A., Kollewe C., Wesche H. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Human HeLa Matchmaker cDNA Library (Clontech) FEBS Lett. (0014-5793) 2003 myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP CEAE3F6B99524333 irak4_human Interleukin-1 receptor-associated kinase 4 Renal carcinoma antigen NY-REN-64 IRAK4 protein protein human Homo sapiens Human MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS DIP protein Q9NWZ3 original sequence version: 93 DIP protein Q9NWZ3 original sequence version: 92 DIP protein Q9NWZ3 original sequence version: 144 6C8156ADF25FF81E peli2_human E3 ubiquitin-protein ligase pellino homolog 2 PELI2 RING-type E3 ubiquitin transferase pellino homolog 2 protein protein human Homo sapiens Human MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID DIP protein Q9HAT8 original sequence version: 60 2FC5E661C13BC11A irak1_human Interleukin-1 receptor-associated kinase 1 IRAK1 IRAK protein protein human Homo sapiens Human MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS DIP protein P51617 original sequence version: 141 DIP protein P51617 original sequence version: 84 DIP protein P51617 original sequence version: 85 DIP protein P51617-1 original sequence version: 103 DIP protein P51617-1 original sequence version: 108 DIP protein P51617 original sequence version: 113 DIP protein P51617 original sequence version: 123 A7ADED75D3A3981D irak4-myd88 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association irak1-peli2-2 3 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association IRAK1 need not be active for interaction to occur, also seen with kinase-dead mutant K339S irak4-peli2-3 3 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association IRAK4 need not be active for interaction to occur, also seen with kinase-dead mutant K213A irak4-peli2-4 2 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 enzyme enzyme unspecified role unspecified role Q9NWZ3:p.Lys213Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:06:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys213ala' Tue Jun 30 18:01:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys213Ala' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation irak1-peli2-3 2 7 enzyme enzyme unspecified role unspecified role P51617:p.Lys239Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K S Wed May 02 18:12:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys239ser' Tue Jun 30 19:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys239Ser' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association irak4-peli2-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association irak4-irak1-1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association