IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GATA4 mutations cause human congenital heart defects and reveal an interaction with TBX5. GATA4 mutations cause human congenital heart defects and reveal an interaction with TBX5. Nature (0028-0836) 2003 Garg V., Kathiriya IS., Barnes R., Schluterman MK., King IN., Butler CA., Rothrock CR., Eapen RS., Hirayama-Yamada K., Joo K., Matsuoka R., Cohen JC., Srivastava D. Vidu.Garg@UTSouthwestern.edu chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Garg V., Kathiriya IS., Barnes R., Schluterman MK., King IN., Butler CA., Rothrock CR., Eapen RS., Hirayama-Yamada K., Joo K., Matsuoka R., Cohen JC., Srivastava D. Vidu.Garg@UTSouthwestern.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2003 gata4_mouse Transcription factor GATA-4 Gata4 Gata-4 GATA-binding factor 4 protein protein mouse Mus musculus Mouse MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSAAAAGTTSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYGSGGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPGRHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGETLPPSSGASSGNSSNATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGPSIHPVLSALKLSPQGYASPVTQTSQASSKQDSWNSLVLADSHGDIITA DIP protein Q08369 original sequence version: 93 E9521771741DD08E nkx25_mouse Homeobox protein Nkx-2.5 Nkx2-5 Csx Nkx-2.5 Nkx2e Homeobox protein NK-2 homolog E Cardiac-specific homeobox Homeobox protein CSX protein protein mouse Mus musculus Mouse MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEAAASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDPAAYAPAYGVGLNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAASANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW DIP protein P42582 original sequence version: 87 DIP protein P42582 original sequence version: 98 6A3E7859F46D4FA6 tbx5_human T-box transcription factor TBX5 TBX5 protein protein human Homo sapiens Human MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS 70118AD84FF5C00F nkx2-5-gata4 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Gata4 was Myc tagged and Nkx2-5 was Flag tagged. Coexpressed in COS1 cells. Both wild type and mutant (G295S) Gata4 interact with Nkx2-5. tbx5-gata4-1 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association TBX5 was Myc tagged and Gata4 was Flag tagged. Coexpressed in COS1 cells. Gata4 mutation (G295S) abolished its interaction with TBX5. Disruption of this interaction by mutations may cause congenital heart defect (CHD). tbx5-gata4-2 1 2 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Gata4 was Myc tagged and TBX5 was Flag tagged. Coexpressed in COS1 cells. Mutations of TBX5 (G80R or R237W) abolished its interaction with Gata4. Disruption of this interaction by mutations may cause congenital heart defects (CHD). nkx2-5-tbx5 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Nkx2-5 was Myc tagged and TBX5 was Flag tagged. Coexpressed in COS1 cells. Mutations of TBX5 (G80R or R237W) abolished its interaction with Nkx2-5.