MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 imex curation Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN., Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 IMEx TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 imex curation Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN., Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Only protein-protein interactions imex curation mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 IMEx TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 imex curation Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN., Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Mouse cDNA Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 IMEx TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 imex curation Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN., Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. sncohen@stanford.edu Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lu Q., Hope LW., Brasch M., Reinhard C., Cohen SN. Origin of proteins inferred from sequence length sncohen@stanford.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 IMEx hgs_mouse Hepatocyte growth factor-regulated tyrosine kinase substrate Hgs Hrs protein protein mouse Mus musculus Mouse MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKTTYTAHPKAEPTPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMAEAPLPETDSQPITPCSGPFSEYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPATFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPTGAPGAQAAPQAQAGPTTSPAYSSYQPTPTPGYQSVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTALPGQDASLPAQQPYIPGQQPLYQQMAPSTGPPQQQPPVAQPAPTQGPPAQGSEAQLISFD DIP protein Q99LI8 original sequence version: 38 DIP protein Q99LI8 original sequence version: 96 DIP protein Q99LI8 original sequence version: 90 DIP protein Q99LI8 original sequence version: 97 DIP protein Q99LI8 original sequence version: 76 0E68BF5AB514865B hgs_human Hepatocyte growth factor-regulated tyrosine kinase substrate Protein pp110 Hrs HGS HRS protein protein human Homo sapiens Human MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD DIP protein O14964 original sequence version: 96 DIP protein O14964 original sequence version: 47 DIP protein O14964 original sequence version: 88 DIP protein O14964-1 original sequence version: 88 DIP protein O14964 original sequence version: 98 DD64167A19DCF030 ts101_human Tumor susceptibility gene 101 protein TSG101 ESCRT-I complex subunit TSG101 protein protein human Homo sapiens Human MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY ADD6912FC22DF162 ts101_mouse Tumor susceptibility gene 101 protein Tsg101 ESCRT-I complex subunit TSG101 protein protein mouse Mus musculus Mouse MAVSESQLKKMMSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIPVRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY 79558EC535093492 hgs-tsg101-7 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99816:p.Tyr63Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:33:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr63ala' Tue Jun 30 17:25:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr63Ala' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q99816:p.Asn45Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:43:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn45ala' Tue Jun 30 18:44:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn45Ala' Q99816:p.Met95Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 16:30:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met95ala' Tue Jun 30 18:14:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met95Ala' Q99816:p.Val89Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V A Wed May 02 20:12:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val89ala' Tue Jun 30 17:54:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val89Ala' Q99816:p.Pro320_Pro323delinsLeuThrAlaLeu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain PTAP LTAL Fri Jul 22 11:13:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ptap motif' Wed May 02 15:00:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_thr_ala_pro320-323leu_thr_ala_leu' Tue Jun 30 16:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro320_Pro323delinsLeuThrAlaLeu' Stoichiometry: 1.0 physical association physical association tsg101-hgs-1 4 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O14964:p.Pro348_Pro351delinsLeuSerAlaLeu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain PSAP LSAL Fri Jul 22 11:10:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'psap motif' Wed May 02 17:45:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_ser_ala_pro348-351leu_ser_ala_leu' Tue Jun 30 20:12:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro348_Pro351delinsLeuSerAlaLeu' O14964:p.Pro348_Pro351delinsLeuAlaGlyLeu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain PSAP LAGL Wed May 02 14:26:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_ser_ala_pro348-351leu_ala_gly_leu' Tue Jun 30 17:09:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro348_Pro351delinsLeuAlaGlyLeu' Stoichiometry: 1.0 physical association physical association homomint mint tsg101-hgs-2 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association hgs-tsg101-1 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association hgs-tsg101-2 2 HRS 5 predetermined predetermined participant predetermined tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 TSG101 7 predetermined predetermined participant predetermined tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged eyfp enhanced yellow fluorescent protein tag eyfp undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F1 homomint mint hgs-tsg101-6 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association