IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the Drosophila Mago nashi-Y14 complex. Crystal structure of the Drosophila Mago nashi-Y14 complex. Genes Dev. (0890-9369) 2003 Shi H., Xu RM. ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi H., Xu RM. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Genes Dev. (0890-9369) 2003 rbm8a_drome RNA-binding protein 8A tsu Y14 CG8781 Protein tsunagi protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR A47BE9ED37CCA045 mgn_drome Protein mago nashi mago mgn CG9401 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI B9A2CBFCC5EBEFED mago-tsu-5 1 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1.85 working 21.5%, free 26.2%