IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK). Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK). Genes Cells (1356-9597) 2002 Goto H., Tanabe K., Manser E., Lim L., Yasui Y., Inagaki M. interaction was detected on SDS-PAGE chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 protein kinase assay protein kinase assay polyclonal western polyclonal antibody western blot polyclonal western Goto H., Tanabe K., Manser E., Lim L., Yasui Y., Inagaki M. interaction was detected on SDS-PAGE Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Genes Cells (1356-9597) 2002 Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK). Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK). Genes Cells (1356-9597) 2002 Goto H., Tanabe K., Manser E., Lim L., Yasui Y., Inagaki M. interaction was detected on SDS-PAGE in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Goto H., Tanabe K., Manser E., Lim L., Yasui Y., Inagaki M. interaction was detected on SDS-PAGE Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Genes Cells (1356-9597) 2002 pak1_rat Serine/threonine-protein kinase PAK 1 p21-activated kinase 1 p68-PAK Alpha-PAK Protein kinase MUK2 Pak1 protein protein rat Rattus norvegicus (Rat) Rat MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein P35465 original sequence version: 113 DIP protein P35465 original sequence version: 125 93BE32D8222F5B7B vime_mouse Vimentin Vim protein protein mouse Mus musculus Mouse MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPTFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE A94EECEA6D70C899 vim-pak1-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 3 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Vimentin is phosphorylted by PAK1. The phosphorylation is restricted to the amino-terminal head domain of vimentin: Ser25, Ser38, Ser50, ser65, and Ser72 vim-pak1-2 1 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 3 enzyme enzyme unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35465:p.Leu107Phe mutation mutation certain certain sequence position certain certain certain sequence position certain L F Wed May 02 16:06:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu107phe' Tue Jun 30 20:13:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu107Phe' phosphorylation phosphorylation reaction phosphorylation Vimentin is phosphorylated. Antibodies which are specific for phosphorylated state of Ser50 (rat monoclonal antibody TM50) and Ser72 (rabbit polyclonal antibody YG72) of vimentin are used. constitutively active form of PAK1 is used: PAK1 L107F