MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of plant protein Ser/Thr phosphatase PP7 with calmodulin. Interaction of plant protein Ser/Thr phosphatase PP7 with calmodulin. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Kutuzov MA., Bennett N., Andreeva AV. no m.kutuzov@usa.net in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr primer specific pcr primer specific pcr Kutuzov MA., Bennett N., Andreeva AV. no m.kutuzov@usa.net Biochem. Biophys. Res. Commun. (0006-291X) 2001 calm1_arath Calmodulin-1/4 CAM1 At5g37780 K22F20.2 T31G3.3 CAM4 At1g66410 T27F4.1 F28G11.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK 805B06B97552ECC1 ppp7_arath Serine/threonine-protein phosphatase 7 PP7 MGI19.7 At5g63870 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METVPPSPITWPDGGALTNDWVHGLMSCFEWSSWNLPPSQLPSLLPVNVFDSLVLTAHKILHKERNCVHIDDLDSVSNVVVVGDIHGQLHDLLFLLKDTGFPCQNRCYVFNGDYVDRGAWGLETFLVLLSWKVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKYGDKGKHVYRKCLGCFEGLPLASIISGRVYTAHGGLFRSPVLPKRTTRGKKNRRVVLLEPEPSSMKLGTLDELMQARRSVLDPPWEGSNLIPGDVLWSDPSMTPGLSPNEQRGIGLLWGPDCTEDFLKKYELKLIIRSHEGPDAREKRTGLGGMDNGYTIDHNVESGKLITIFSAPDYPQFQATEERYKNKGAYIILQAPDFSDPQFHSFEAVKPRPKAHPYYDFENVIDSDDEMDKSAMDTNNEQPNS mint Phosphatase active on para-nitrophenylphosphate (pNPP) and on various phosphoproteins such as myelin basic protein. Seems to act as a positive regulator of cryptochrome signaling involved in hypocotyl growth inhibition and cotyledon expansion under white and blue light conditions. Confers thermotolerance. Required for heat shock mediated-signaling pathway that leads to the expression of heat shock proteins (HSPs) 111A9E01A222A058 pp7-cam1 1 3 primer specific pcr primer specific pcr predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-595022: original sequence: 1-209 : METVPPSPITWPDGGALTNDWVHGLMSCFEWSSWNLPPSQLPSLLPVNVFDSLVLTAHKILHKERNCVHIDDLDSVSNVVVVGDIHGQLHDLLFLLKDTGFPCQNRCYVFNGDYVDRGAWGLETFLVLLSWKVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKYGDKGKHVYRKCLGCFEGLPLASIISGRVYTAHGGLFRSPVLPK Stoichiometry: 1.0 2 primer specific pcr primer specific pcr predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction mint