MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 imaging technique imaging technique microscopy immunostaining immunostaining Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. cannot find anything close to this experiment in the paper. participant detection updated from root term to western blot accordingly with the paper. The tags are not properly reported in the interaction EBI-443718, easier it the curator that originally create the entry revisit it. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip protein sequence protein sequence identification protein sequence Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins. J. Biol. Chem. (0021-9258) 2002 Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gubitz AK., Mourelatos Z., Abel L., Rappsilber J., Mann M., Dreyfuss G. Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 rsmb_human Small nuclear ribonucleoprotein-associated proteins B and B' Sm protein B/B' SNRPB COD SNRPB1 protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP DIP protein P14678 original sequence version: 150 DIP protein P14678 original sequence version: 131 DIP protein P14678 original sequence version: 186 F2E1D5E11A601170 ispe_eco57 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase ispE Z1979 4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase ECs1713 protein protein eco57 Escherichia coli O157:H7 MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGANLSPLHRAML 59A2921FA05D13E1 smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR DIP protein P62318 original sequence version: 72 DIP protein P62318 original sequence version: 95 DIP protein P62318 original sequence version: 81 DIP protein P62318 original sequence version: 102 DIP protein P62318 original sequence version: 131 59A6E78E860AA3E0 smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN DIP protein P62304 original sequence version: 64 DIP protein P62304 original sequence version: 87 DIP protein P62304 original sequence version: 73 DIP protein P62304 original sequence version: 123 7D8881CE1F4FA2FD smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR DIP protein P62314 original sequence version: 77 DIP protein P62314 original sequence version: 100 DIP protein P62314 original sequence version: 86 DIP protein P62314 original sequence version: 135 0C81C94BF98E0810 gemi4_human Gem-associated protein 4 GEMIN4 Component of gems 4 p97 protein protein human Homo sapiens Human MDLGPLNICEEMTILHGGFLLAEQLFHPKALAELTKSDWERVGRPIVEALREISSAAAHSQPFAWKKKALIIIWAKVLQPHPVTPSDTETRWQEDLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAMAHKYLPALDEFPHPPKRLRSDPDACPTMPLLAMLLRGLTQIQSRILGPGRKCCALANLADMLTVFALTEDDPQEVSATVYLDKLATVISVWNSDTQNPYHQQALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLRSSQGTSYDSYRLCDSLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHMEVCYIFASEKKWAFSDEWVACLGSNRALFRQPDLVLRLLETVIDVSTADRAIPESQIRQVIHLILECYADLSLPGKNKVLAGILRSWGRKGLSEKLLAYVEGFQEDLNTTFNQLTQSASEQGLAKAVASVARLVIVHPEVTVKKMCSLAVVNLGTHKFLAQILTAFPALRFVEEQGPNSSATFMVSCLKETVWMKFSTPKEEKQFLELLNCLMSPVKPQGIPVAALLEPDEVLKEFVLPFLRLDVEEVDLSLRIFIQTLEANACREEYWLQTCSPFPLLFSLCQLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTVGLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDVGNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQLSVLFLRTFQFLCSHSCRDWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSSF ACEC60EC19EF5081 ddx20_human Probable ATP-dependent RNA helicase DDX20 DDX20 DP103 GEMIN3 DEAD box protein 20 DEAD box protein DP 103 Component of gems 3 Gemin-3 protein protein human Homo sapiens Human MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKVVNSYPLAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQRLDAMAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVIEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ DIP protein Q9UHI6 original sequence version: 120 76712F014B2A0CF2 gemi5_human Gem-associated protein 5 GEMIN5 protein protein human Homo sapiens Human MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGELVGHTERVSGFTFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPRVKDLIVSGDEKGVVFCYWFNRNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIIDISKKGEVIHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGCYLATGSKDQTIRIWSCSRGRGVMILKLPFLKRRGGGIDPTVKERLWLTLHWPSNQPTQLVSSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRDVKCWDIATLECSWTLPSLGGFAYSLAFSSVDIGSLAIGVGDGMIRVWNTLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPVHTEISWKADGKIMALGNEDGSIEIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMASGSNNAVIYVHNLKTVIESSPESPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSASYDGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYSGADDFCVHKWLTSMQDHSRPPQGKKSIELEKKRLSQPKAKPKKKKKPTLRTPVKLESIDGNEEESMKENSGPVENGVSDQEGEEQAREPELPCGLAPAVSREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKPETLIKKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSRELNEDVSADVEERFHLGLFTDRATLYRMIDIEGKGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAPAAGYHVWLWAVEAFAKQLCFQDQYVKAASHLLSIHKVYEAVELLKSNHFYREAIAIAKARLRPEDPVLKDLYLSWGTVLERDGHYAVAAKCYLGATCAYDAAKVLAKKGDAASLRTAAELAAIVGEDELSASLALRCAQELLLANNWVGAQEALQLHESLQGQRLVFCLLELLSRHLEEKQLSEGKSSSSYHTWNTGTEGPFVERVTAVWKSIFSLDTPEQYQEAFQKLQNIKYPSATNNTPAKQLLLHICHDLTLAVLSQQMASWDEAVQALLRAVVRSYDSGSFTIMQEVYSAFLPDGCDHLRDKLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPETSQPEPNRPSELDLRLTEEGERMLSTFKELFSEKHASLQNSQRTVAEVQETLAEMIRQHQKSQLCKSTANGPDKNEPEVEAEQPLCSSQSQCKEEKNEPLSLPELTKRLTEANQRMAKFPESIKAWPFPDVLECCLVLLLIRSHFPGCLAQEMQQQAQELLQKYGNTKTYRRHCQTFCM EA5293F395BBF14E gemi2_human Gem-associated protein 2 GEMIN2 SIP1 Component of gems 2 Survival of motor neuron protein-interacting protein 1 protein protein human Homo sapiens Human MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS DIP protein O14893 original sequence version: 146 DIP protein O14893 original sequence version: 114 3232F410EA98EB81 gemin5-gemin4-1 5 16 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association gemin5-smn1-1 5 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association gemin5-ddx20-1 4 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association smn1-gemin5-1 6 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association gemin5-smn1-2 2 16 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization gemin5-smn1-3 7 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 16 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association gemin5-smn1-4 7 16 unspecified role unspecified role prey prey s35 met gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 17 unspecified role unspecified role prey prey s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association bait protein is GST-tagged, prey protein smn1 is His-tagged and prey protein gemin5 is V5-tagged Revisit when protein editor in place gemin5-snrpd1-1 3 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) association association gemin5-snrpe-1 1 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association gemin5-smn1-5 1 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) physical association physical association Bait protein is GST-tagged and prey protein is His tagged Revisit when protein editor in place