MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of the TPR domain of p67phox in complex with Rac.GTP. Structure of the TPR domain of p67phox in complex with Rac.GTP. Mol. Cell (1097-2765) 2000 Lapouge K., Smith SJ., Walker PA., Gamblin SJ., Smerdon SJ., Rittinger K. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lapouge K., Smith SJ., Walker PA., Gamblin SJ., Smerdon SJ., Rittinger K. no Mol. Cell (1097-2765) 2000 Structure of the TPR domain of p67phox in complex with Rac.GTP. Structure of the TPR domain of p67phox in complex with Rac.GTP. Mol. Cell (1097-2765) 2000 Lapouge K., Smith SJ., Walker PA., Gamblin SJ., Smerdon SJ., Rittinger K. no in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lapouge K., Smith SJ., Walker PA., Gamblin SJ., Smerdon SJ., Rittinger K. no Mol. Cell (1097-2765) 2000 ncf2_human Neutrophil cytosol factor 2 NOXA2 P67PHOX Neutrophil NADPH oxidase factor 2 NADPH oxidase activator 2 67 kDa neutrophil oxidase factor p67-phox NCF2 protein protein human Homo sapiens Human MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGECKGKVGIFPKVFVEDCATTDLESTRREV DIP protein P19878 original sequence version: 148 EC136766E1915376 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 rac2_human Ras-related C3 botulinum toxin substrate 2 p21-Rac2 Small G protein GX RAC2 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL DIP protein P15153 original sequence version: 154 DIP protein P15153 original sequence version: 153 DIP protein P15153 original sequence version: 123 2A1F1266B07C3210 cdc42-ncf2-1 2 4 unspecified role unspecified role neutral component neutral component P60953:p.[Lys27Ala;Ser30Gly] mutation mutation certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain S G Fri Jul 22 10:50:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30gly,lys27ala' Wed May 02 19:03:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys27ala,ser30gly' Tue Jun 30 18:35:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys27Ala;Ser30Gly]' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component tpr domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Cdc42 is GMPNP-bound stoichiometry is 1-1 : add it when possible Only if mutated (K24A S30G), cdc42 can bind to P67 phox TPR domains rac1-ncf2-2 2 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component P63000:p.Gln61Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 19:22:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 18:32:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' ecoli Escherichia coli (strain K12) physical association physical association Rac1 Q61L is GTP-bound stoichiometry is 1-1 : add it when possible the interaction is GTP dependent. No heat change for titration of p67 by Rac1 GDP rac2-ncf2-1 2 6 unspecified role unspecified role neutral component neutral component P15153:p.Gln61Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 19:25:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 18:10:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component tpr domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Rac2 Q61L is GTP-bound stoichiometry is 1-1 : add it when possible the interaction is GTP dependent. No heat change for titration of p67 into Rac2 GDP rac1-ncf2-3 1 5 unspecified role unspecified role neutral component neutral component P63000:p.Gln61Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:50:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 19:37:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component tpr domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Rac1 Q61L is GTP-bound stoichiometry is 1-1 : add it when possible 2.40 working 24.4%, free 28.4%