IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. Nat. Cell Biol. (1465-7392) 2000 Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Cell Biol. (1465-7392) 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. Nat. Cell Biol. (1465-7392) 2000 Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Cell Biol. (1465-7392) 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. Nat. Cell Biol. (1465-7392) 2000 Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Cell Biol. (1465-7392) 2000 The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. Nat. Cell Biol. (1465-7392) 2000 Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Joberty G., Petersen C., Gao L., Macara IG. Growth on selective media used for identification of interacting proteins. gmj4h@virginia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Cell Biol. (1465-7392) 2000 par6a_human Partitioning defective 6 homolog alpha PARD6A PAR6A PAR6C Tax interaction protein 40 protein protein human Homo sapiens Human MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL DIP protein Q9NPB6 original sequence version: 130 9241E0EDC3694AD4 par6b_mouse Partitioning defective 6 homolog beta Pard6b Par6b protein protein mouse Mus musculus Mouse MNRGHRHGASSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIRKKNMLSNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSSQSTDNSLLGFPQQVEASFEPEDQDSDEDDIIIEDSGEPQQIPKATPAQSLESLTQIELSFESGQNGFSPPQDTSLVPVPGSLDTELESRAPDQKLLEEDGTIITL 664C7D25262494A9 kpci_mouse Protein kinase C iota type Prkci nPKC-iota Atypical protein kinase C-lambda/iota Pkcl protein protein mouse Mus musculus Mouse MPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDQTMHPDHTQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV DIP protein Q62074 original sequence version: 139 DIP protein Q62074 original sequence version: 131 6AC612D1E9264825 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 cdc42_mouse Cell division control protein 42 homolog Cdc42 G25K GTP-binding protein protein protein mouse Mus musculus Mouse MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60766 original sequence version: 61 51A437E22A4D8FFF tcp10_human Putative T-complex protein 10A homolog TCP10L3 T-complex 10 like 3, pseudogene TCP10 TCP10A protein protein human Homo sapiens Human MLEGQLEAGEPKEGTHPEDPCPGAGAAMEKTPAAAEVPREDSNAGEMPSLQQQITSLHQELGRQQSLWADIHRKLQSHMDALRKQNRELREELRGLQRQQWEAGKKPAASPHAGRESHTLALEPAFGKISHLSADEDTTPKYAGRKSQSATLLGQRWSSNHLAPPKPMSLKTERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMHPSSRSPQNSGGRKSPVQASQATTLQEQTAAARGADRSSSVLGSSEGGFLSRVQADEFASSAPDSAERQNLPVNPPSSLEIAQAMDTKMKKEEVQEEKRHPKGKADDCRRSGFPSEFPGALHAAPSRQDMGP The sequence has been withdrawn from uniprot. 4AC5FA1886BF0977 par6a_mouse Partitioning defective 6 homolog alpha Pard6a Par6a protein protein mouse Mus musculus Mouse MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEGDSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDSSDLVIENRHPPCSNGLSQGPLCWDLQPGCLLPGAGSSLPSLDSREQANSGWGNGMRGDVSGFSL DIP protein Q9Z101 original sequence version: 97 8F150B83B7E1F36A pard3_human Partitioning defective 3 homolog PARD3 PAR3 PAR3A Atypical PKC isotype-specific-interacting protein CTCL tumor antigen se2-5 PAR3-alpha protein protein human Homo sapiens Human MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS DIP protein Q8TEW0 original sequence version: 130 DIP protein Q8TEW0 original sequence version: 137 DIP protein Q8TEW0 original sequence version: 142 DIP protein Q8TEW0 original sequence version: 110 A4FD3F4F9AD8B92A pard6a-tcp10-1 2 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association pard6a-cdc42-1 2 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Revisit when Swiss Prot demerges. pard6a-rac1-1 2 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Revisit when Swiss Prot demerges. pard6b-tcp10-1 2 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association pard6b-cdc42-1 2 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Revisit when Swiss Prot demerges. pard6a-tcp10-2 2 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association pard6a-cdc42-2 2 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Revisit when Swiss Prot demerges. pard6b-tcp10-2 2 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association AA126-253 of Pard6B interacts with TCP10. Revisit when Protein Editor in place. pard6b-cdc42-2 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Revisit when Protein Editor in place. Revisit when Swiss Prot demerges. pard6a-tcp10-3 2 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association AA 125-252 of Par6C involved in the interaction. Revisit when Protein Editor in place. pard6a-cdc42-3 2 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place. Revisit when Swiss Prot demerges. pard6b-cdc42-3 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Revisit when Protein Editor in place. Revisit when Swiss Prot demerges. AA 126-253 of Pard6B involved in the interaction. CDC42 was myc tagged and Pard6B was HA tagged. pard3-pard6b-1 1 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Par3 was myc tagged while Pard6B was HA tagged. AA 126-253 of Pard6B was enough for coprecipitation. Revisit when Protein Editor in place. pard6b-pard3-1 3 13 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association AA 1-373 of Pard3 was enough for the interaction. HA tagged Pard6B Revisit when Protein Editor in place. pard3-prkci-1 4 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association HA-Par6B and Myc tagged Cdc42, PkCi and Par3 used in the experiment. Revisit when Protein Editor in place.