IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BOD (Bcl-2-related ovarian death gene) is an ovarian BH3 domain-containing proapoptotic Bcl-2 protein capable of dimerization with diverse antiapoptotic Bcl-2 members. BOD (Bcl-2-related ovarian death gene) is an ovarian BH3 domain-containing proapoptotic Bcl-2 protein capable of dimerization with diverse antiapoptotic Bcl-2 members. Mol. Endocrinol. (0888-8809) 1998 Hsu SY., Lin P., Hsueh AJ. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsu SY., Lin P., Hsueh AJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Endocrinol. (0888-8809) 1998 b2cl1_rat Bcl-2-like protein 1 Bcl2l1 Bclx Blc2l Apoptosis regulator Bcl-X protein protein rat Rattus norvegicus (Rat) Rat MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK 2B62B6C63864BC8F o88996_rat Bcl2l2 bcl-w rCG_23437 protein protein rat Rattus norvegicus (Rat) Rat MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK 36D6742F4529AFB4 mcl1_rat Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Mcl1 protein protein rat Rattus norvegicus (Rat) Rat MFGLRRNAVIGLNLYCGGASLGAGGGSPAGTRLAAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPPEEMAASAAAIMSPEEELDGCEPEVLSKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEDDELYRQSLEIISRYLREQATGSKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSFSRVMTHVFKDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR C4A9DEB41897258E bcl2_rat Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein rat Rattus norvegicus (Rat) Rat MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P49950 original sequence version: 87 E7688CB9071A872A b2l11_rat Bcl-2-like protein 11 Bcl2l11 Bim Bod Bcl2-interacting mediator of cell death Bcl-2-related ovarian death protein protein protein rat Rattus norvegicus (Rat) Rat MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH B4D2146F9C0B37A0 q925a9_rat Bcl2a1 Bcl2a1d protein protein rat Rattus norvegicus (Rat) Rat MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQMTGKIWEMLFLLKQHY 3E1FB6C763BBA8B2 mcl_1-bcl2l11-1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association bcl2l11-mcl_1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association bcl2l11-bcl2-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association bcl2l11-bcl2l1-1 1 6 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association bcl2l11-bcl_w-1 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association bcl2l11-bcl2a1-1 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association