MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Blood (0006-4971) 1998 imex curation Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. cDNAs from human B-lymphocyte, bone marrow, fetal liver, and HeLa cells Blood (0006-4971) 1998 IMEx Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Blood (0006-4971) 1998 imex curation Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Blood (0006-4971) 1998 IMEx Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Blood (0006-4971) 1998 imex curation Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Only protein-protein interactions imex curation mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Blood (0006-4971) 1998 IMEx Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Blood (0006-4971) 1998 imex curation Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. cDNAs from human B-lymphocyte, bone marrow, fetal liver, and HeLa cells Blood (0006-4971) 1998 IMEx Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Molecular chaperone GRP94 binds to the Fanconi anemia group C protein and regulates its intracellular expression. Blood (0006-4971) 1998 imex curation Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hoshino T., Wang J., Devetten MP., Iwata N., Kajigaya S., Wise RJ., Liu JM., Youssoufian H. Blood (0006-4971) 1998 IMEx enpl_mouse Endoplasmin Heat shock protein 90 kDa beta member 1 94 kDa glucose-regulated protein Grp94 Endoplasmic reticulum resident protein 99 Polymorphic tumor rejection antigen 1 Tumor rejection antigen gp96 Hsp90b1 Tra-1 Tra1 protein protein mouse Mus musculus Mouse MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDTSEDAEDSEQDEGEEMDAGTEEEEEETEKESTEKDEL DIP protein P08113 original sequence version: 113 BDF33B9BD86BFC5F fancc_mouse Fanconi anemia group C protein homolog Fancc Fac Facc protein protein mouse Mus musculus Mouse MAQESADLASDCQSWLQKLSAWEQASSEETQKDTCLHLSGFQEFLRQMYEILKEMDSDAILERFPTIGQLLAKACWNPLILAYDESQKIVIWCLCCLMNKEPRTSAESGLNSWIRGLLSHVLSAFRFDMKEVCLFTKSLGYESIDYYPSLLKNMVLSLVSELRESHLNGLSTQSRMAPERMMSLSEVCVPLVTLPDMEPLVEALLTYHGHEPQEVLAPEFFEAVNEAFLSEKIVLPTSSVVSLWFRHLPSLEKATLHLFEKLFSSKIICLRRMECCIRESFLPQAACQPAIFRIVDEMFRFVLLETDGAPEVLAALQVFTSCLVEALKKENKQLTFALRTYFPYGAPCLAAALSQHPEAIPQGHRLQPLLHISQLLREAVEDCTRGSPRNPFESWFLFVHFGGWVDLAVAELLLREEAEPPAGLLWLLVFYYSPQDGSQQREQSMVELKVLINRLLMLLRSGPLSATDLQEAAESPSGDPRPPVCGQLVRRLLLSLLLWTPEGHAIVWEAVTHGPTFEITGPGCCPRIWRSTRPQHRPRAHLCCTEMAHTDAVIHEIIGFLDQTLYRSQHLCVEASRKLARDLLKELQAQV 97DA796F55D8A68A fancc_human Fanconi anemia group C protein FANCC FAC FACC protein protein human Homo sapiens Human MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSSLPQAACHPAIFRVVDEMFRCALLETDGALEIIATIQVFTQCFVEALEKASKQLRFALKTYFPYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPRSEKLARELLKELRTQV DIP protein Q00597 original sequence version: 110 C9DDFFAC725D050C enpl_human Endoplasmin HSP90B1 TRA1 Heat shock protein 90 kDa beta member 1 94 kDa glucose-regulated protein GRP94 gp96 homolog Tumor rejection antigen 1 protein protein human Homo sapiens Human MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL DIP protein P14625 original sequence version: 187 DIP protein P14625 original sequence version: 141 9BF6705A7A2ED0D0 fancc-hsp90b1-1 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint fancc-hsp90b1-2 4 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain range MINT-1535247: original sequence: 103-308 : QNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSSLPQAACHPAIFRVVDEMFRCALLETDG tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 physical association physical association Fig. 1 fancc-hsp90b1-3 5 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed Stoichiometry: 1.0 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint 2 fancc-hsp90b1-4 2 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed Stoichiometry: 1.0 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint Fig. 2 fancc-hsp90b1-5 3 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed Stoichiometry: 1.0 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint Fig. 3