IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between the amino-terminal domain of p56lck and cytoplasmic domains of CD4 and CD8 alpha in yeast. Interactions between the amino-terminal domain of p56lck and cytoplasmic domains of CD4 and CD8 alpha in yeast. Eur. J. Immunol. (0014-2980) 1995 Campbell KS., Buder A., Deuschle U. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Campbell KS., Buder A., Deuschle U. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Eur. J. Immunol. (0014-2980) 1995 lck_mouse Proto-oncogene tyrosine-protein kinase LCK Lck Lsk-t Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein mouse Mus musculus Mouse MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYLRSVLDDFFTATEGQYQPQP 3513102F49A7FD0B cd8a_mouse T-cell surface glycoprotein CD8 alpha chain Cd8a Lyt-2 Lyt2 T-cell surface glycoprotein Lyt-2 protein protein mouse Mus musculus Mouse MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV 22D0D78ECEC3EA04 cd4_mouse T-cell surface glycoprotein CD4 Cd4 T-cell surface antigen T4/Leu-3 T-cell differentiation antigen L3T4 protein protein mouse Mus musculus Mouse MCRAISLRRLLLLLLQLSQLLAVTQGKTLVLGKEGESAELPCESSQKKITVFTWKFSDQRKILGQHGKGVLIRGGSPSQFDRFDSKKGAWEKGSFPLIINKLKMEDSQTYICELENRKEEVELWVFKVTFSPGTSLLQGQSLTLTLDSNSKVSNPLTECKHKKGKVVSGSKVLSMSNLRVQDSDFWNCTVTLDQKKNWFGMTLSVLGFQSTAITAYKSEGESAEFSFPLNFAEENGWGELMWKAEKDSFFQPWISFSIKNKEVSVQKSTKDLKLQLKETLPLTLKIPQVSLQFAGSGNLTLTLDKGTLHQEVNLVVMKVAQLNNTLTCEVMGPTSPKMRLTLKQENQEARVSEEQKVVQVVAPETGLWQCLLSEGDKVKMDSRIQVLSRGVNQTVFLACVLGGSFGFLGFLGLCILCCVRCRHQQRQAARMSQIKRLLSEKKTCQCPHRMQKSHNLI 1B1DA7527CB00F33 lck-cd4-1 1 2 unspecified role unspecified role prey prey n-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P06240:p.Cys20Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:32:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ala' Tue Jun 30 16:39:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys20Ala' P06240:p.Cys23Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:16:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys23ala' Tue Jun 30 19:15:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys23Ala' 4 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-530692]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 458-458, sequence length 457 [EBI-530692]421-458 7 11 physical association physical association Interaction inhibited the growth of yeast lck-cd8alpha-1 1 2 unspecified role unspecified role prey prey P06240:p.Cys20Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 14:56:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ala' Tue Jun 30 19:24:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys20Ala' P06240:p.Cys23Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:50:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys23ala' Tue Jun 30 16:57:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys23Ala' n-terminus binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-530700]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 248-248, sequence length 247 [EBI-530700]222-248 16 18 physical association physical association In same experiment, interaction between Lck and CD8alpha chain was shown to be 8-fold weaker than between CD4 and Lck.