MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. Nat. Genet. (1061-4036) 2003 imex curation Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Nat. Genet. (1061-4036) 2003 IMEx 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. Nat. Genet. (1061-4036) 2003 imex curation Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. mouse fetal brain Nat. Genet. (1061-4036) 2003 IMEx 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. Nat. Genet. (1061-4036) 2003 imex curation Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Nat. Genet. (1061-4036) 2003 IMEx 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. Nat. Genet. (1061-4036) 2003 imex curation Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging western blot western blot Immuno blot Immuno blot Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Nat. Genet. (1061-4036) 2003 IMEx 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. Nat. Genet. (1061-4036) 2003 imex curation Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Nat. Genet. (1061-4036) 2003 IMEx 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. Nat. Genet. (1061-4036) 2003 imex curation Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_brain Mouse embryonic brain embryonic_brain anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Toyo-oka K., Shionoya A., Gambello MJ., Cardoso C., Leventer R., Ward HL., Ayala R., Tsai LH., Dobyns W., Ledbetter D., Hirotsune S., Wynshaw-Boris A. Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Nat. Genet. (1061-4036) 2003 IMEx 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63101 original sequence version: 72 2164DF3793B45B7A 1433b_mouse 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Ywhab protein protein mouse Mus musculus Mouse MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 51C366ED85B38EED 1433t_mouse 14-3-3 protein theta Ywhaq 14-3-3 protein tau protein protein mouse Mus musculus Mouse MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN E30471260E8B366E lis1_mouse Platelet-activating factor acetylhydrolase IB subunit beta PAF acetylhydrolase 45 kDa subunit PAF-AH alpha Lissencephaly-1 protein Pafah1b1 Lis1 Lis-1 Pafaha protein protein mouse Mus musculus Mouse MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR DIP protein P63005 original sequence version: 47 4DBF6A24A6B131CD 1433e_mouse 14-3-3 protein epsilon Ywhae protein protein mouse Mus musculus Mouse MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 07817CCBD1F75B26 1433g_mouse 14-3-3 protein gamma Ywhag protein protein mouse Mus musculus Mouse MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN B0D16C6DE1F4455D ndel1_mouse Nuclear distribution protein nudE-like 1 Protein mNudE-like Ndel1 Nudel protein protein mouse Mus musculus Mouse MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENSFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYVPGSVNCGVMNSNGPECPRSGRATFFHKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV DIP protein Q9ERR1 original sequence version: 37 CB3059DFD998E9EC ndel1-ywhae-4 3 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9ERR1:p.Ser198Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:48:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser198ala' Tue Jun 30 19:39:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser198Ala' Q9ERR1:p.Ser231Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:10:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser231ala' Tue Jun 30 19:48:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser231Ala' Q9ERR1:p.Thr219Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:11:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr219ala' Tue Jun 30 16:10:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr219Ala' Q9ERR1:p.[Ser198Ala;Thr219Ala;Ser231Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:07:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser198ala,thr219ala,ser231ala' Tue Jun 30 17:05:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser198Ala;Thr219Ala;Ser231Ala]' Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Fig 5B Rroscovitine (CHEBI:45307) - CDK5 inhibitor mint ndel1-pafah1b1-8 3 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ndel1-ywhae-1 1 11 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 13 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9ERR1:p.Ser198Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:21:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser198ala' Tue Jun 30 18:34:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser198Ala' Q9ERR1:p.Ser231Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:19:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser231ala' Tue Jun 30 18:10:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser231Ala' Q9ERR1:p.Thr219Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:28:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr219ala' Tue Jun 30 16:07:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr219Ala' Q9ERR1:p.[Ser198Ala;Thr219Ala;Ser231Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:10:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser198ala,thr219ala,ser231ala' Tue Jun 30 17:46:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser198Ala;Thr219Ala;Ser231Ala]' Stoichiometry: 1.0 physical association physical association Fig 5D mint ndel1-ywhae-2 6 10 unspecified role unspecified role prey prey NDEL1_MOUSE 13 unspecified role unspecified role bait bait 1433E_MOUSE 11 unspecified role unspecified role prey prey association association Fig 5F Other 14-3-3 isoforms were present but not unambiguously identified. ndel1-ywhae-3 2 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ndel1-pafah1b1-1 2 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ndel1-ywhab-1 2 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ndel1-ywhag-1 2 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ndel1-ywhaq-1 2 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ndel1-ywhaz-1 2 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ywhae-ndel1-1 1 11 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 13 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9ERR1:p.Ser198Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:35:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser198ala' Tue Jun 30 17:49:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser198Ala' Q9ERR1:p.Ser231Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:49:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser231ala' Tue Jun 30 19:02:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser231Ala' Q9ERR1:p.Thr219Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:21:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr219ala' Tue Jun 30 16:47:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr219Ala' Q9ERR1:p.[Ser198Ala;Thr219Ala;Ser231Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:25:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser198ala,thr219ala,ser231ala' Tue Jun 30 18:32:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser198Ala;Thr219Ala;Ser231Ala]' Stoichiometry: 1.0 physical association physical association Fig 5E mint ndel1-pafah1b1-2 5 10 unspecified role unspecified role prey prey NDEL1_MOUSE 13 unspecified role unspecified role bait bait 1433E_MOUSE 11 unspecified role unspecified role prey prey association association Fig 5F Other 14-3-3 isoforms were present but not unambiguously identified. ndel1-pafah1b1-3 4 NDEL1_MOUSE 13 unspecified role unspecified role neutral component neutral component 1433E_MOUSE 11 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 5F Other 14-3-3 isoforms were present but not unambiguously identified.