MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Cell (0092-8674) 2002 O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no Cell (0092-8674) 2002 partial coverage rapid curation Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Cell (0092-8674) 2002 O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no partial coverage rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no Cell (0092-8674) 2002 partial coverage rapid curation Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Cell (0092-8674) 2002 O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no Cell (0092-8674) 2002 partial coverage rapid curation Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Cell (0092-8674) 2002 O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no partial coverage rapid curation in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no Cell (0092-8674) 2002 partial coverage rapid curation Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Cell (0092-8674) 2002 O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no partial coverage rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined O'Kelly I., Butler MH., Zilberberg N., Goldstein SA. no Cell (0092-8674) 2002 partial coverage rapid curation kcnk3_human Potassium channel subfamily K member 3 KCNK3 TASK TASK1 Acid-sensitive potassium channel protein TASK-1 TWIK-related acid-sensitive K(+) channel 1 Two pore potassium channel KT3.1 protein protein human Homo sapiens Human MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSHYEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV mint pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward 9FF4C8266F615FB7 1433b_rat 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Prepronerve growth factor RNH-1 Ywhab protein protein rat Rattus norvegicus (Rat) Rat MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN B663D1F2182F9C43 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 ywhab-kcnk3 1 6 unspecified role unspecified role prey prey purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-1645495: original sequence: 393-393 : TFRGLMKRRSS binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1645493: original sequence: 390-394 : SLSTFRGLMKRRSS Stoichiometry: 1.0 8 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint domino mint ywhab-kcnk3-1 4 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1660545: original sequence: 390-394 : SLSTFRGLMKRRSS phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-1660547: original sequence: 393-393 : TFRGLMKRRSS Stoichiometry: 1.0 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint domino mint kcnk3-ywhab 5 KCNK3_HUMAN 6 unspecified role unspecified role unspecified role unspecified role 1433B_HUMAN 8 unspecified role unspecified role unspecified role unspecified role physical association physical association homomint domino mint kcnk3-ywhab-1 2 KCNK3_HUMAN 6 unspecified role unspecified role unspecified role unspecified role 1433B_RAT 7 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint kcnk3-ywhab-2 5 KCNK3_HUMAN 6 unspecified role unspecified role unspecified role unspecified role 1433B_HUMAN 8 unspecified role unspecified role unspecified role unspecified role physical association physical association homomint domino mint kcnk3-ywhab-3 3 KCNK3_HUMAN 6 unspecified role unspecified role unspecified role unspecified role 1433B_RAT 7 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint