IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. J. Biol. Chem. (0021-9258) 2002 Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Alzheimers - Interactions investigated in the context of Alzheimers disease Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. J. Biol. Chem. (0021-9258) 2002 Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Alzheimers - Interactions investigated in the context of Alzheimers disease Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. J. Biol. Chem. (0021-9258) 2002 Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Alzheimers - Interactions investigated in the context of Alzheimers disease Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. J. Biol. Chem. (0021-9258) 2002 Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Alzheimers - Interactions investigated in the context of Alzheimers disease Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. J. Biol. Chem. (0021-9258) 2002 Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Taru H., Iijima K., Hase M., Kirino Y., Yagi Y., Suzuki T. Alzheimers - Interactions investigated in the context of Alzheimers disease Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 a4_drome Amyloid-beta-like protein Appl CG7727 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MCAALRRNLLLRSLWVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQMRSFAMLLPCGISVFSGVEFVCCPKHFKTDEIHVKKTDLPVMPAAQINSANDELVMNDEDDSNDSNYSKDANEDDLDDEDDLMGDDEEDDMVADEAATAGGSPNTGSSGDSNSGSLDDINAEYDSGEEGDNYEEDGAGSESEAEVEASWDQSGGAKVVSLKSDSSSPSSAPVAPAPEKAPVKSESVTSTPQLSASAAAFVAANSGNSGTGAGAPPSTAQPTSDPYFTHFDPHYEHQSYKVSQKRLEESHREKVTRVMKDWSDLEEKYQDMRLADPKAAQSFKQRMTARFQTSVQALEEEGNAEKHQLAAMHQQRVLAHINQRKREAMTCYTQALTEQPPNAHHVEKCLQKLLRALHKDRAHALAHYRHLLNSGGPGGLEAAASERPRTLERLIDIDRAVNQSMTMLKRYPELSAKIAQLMNDYILALRSKDDIPGSSLGMSEEAEAGILDKYRVEIERKVAEKERLRLAEKQRKEQRAAEREKLREEKLRLEAKKVDDMLKSQVAEQQSQPTQSSTQSQAQQQQQEKSLPGKELGPDAALVTAANPNLETTKSEKDLSDTEYGEATVSSTKVQTVLPTVDDDAVQRAVEDVAAAVAHQEAEPQVQHFMTHDLGHRESSFSLRREFAQHAHAAKEGRNVYFTLSFAGIALMAAVFVGVAVAKWRTSRSPHAQGFIEVDQNVTTHHPIVREEKIVPNMQINGYENPTYKYFEVKE F0F0855AD65A5275 klc_drome Kinesin light chain Klc CG5433 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLSQLLTSNEKRRSKAIKEDLDFSEEKNAKP DIP protein P46824 original sequence version: 100 B7893FF47EE638A9 jip1_mouse C-Jun-amino-terminal kinase-interacting protein 1 Mapk8ip1 Ib1 Jip1 Mapk8ip Prkm8ip Islet-brain-1 Mitogen-activated protein kinase 8-interacting protein 1 JNK MAP kinase scaffold protein 1 protein protein mouse Mus musculus Mouse MAERESGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGSSGSAGSRLQAEMLQMDLIDAAGDTPGAEDDEEEEDDELAAQRPGVGPPKAESNQDPAPRSQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRSAATQMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFMPPTESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDALEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE 274013B12D91049D q9wv19_mouse Cytochrome P450 Cyp2g1 protein protein mouse Mus musculus Mouse MMLGGAFSIFMALCLSCLLILIAWKRTSKGGKLPPGPTPIPFLGNFLQVRTDATFQSFQKLQKKYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADDFSGRGEMPTLEKNFQGYGLALSNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKVKGAPIDPTLYLSRTVSNVICSVVFGKRFDYQDQRFQSLMRMINESFVEMSKPWAQLYDMYWKVMQYFPGRHNYLYNLIEDLKDFIASRVKINEASFDPSNPRDFIDCFLIKMHQDKSDPHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVEAKIHEEINQVIGTHRTPRVDDRAKMPYTDAVIHEIQRLTDIVPLGVPHNVTRDTHFRGYLLPKGTDVYPLFGSVLKDPKYFRYPDAFYPQHFLDEQGRFKKNDAFVVFSSGKRICVGEALARMELFLYFTSILQRFSLRSLVPPADIDIAHKISGFGNIPPVYELCFMAR 63D83B09DB08AB9F hep_drome Dual specificity mitogen-activated protein kinase kinase hemipterous hep hem MKK7 CG4353 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGARGPVVSGSVPSARVPPLATSASAATSATHAPSLGAGSVSGSGISIAQRPAPPVPHATPFGSASASSSSSSASAFASAAPATGTFGGTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQRATATGSAIGSGAGSLAGSGSGSAGGAVKYGRATTYAGQSPTNPQKTIKPTQIPSYQQQQSQFFMQSATQLPQTTTTTPTATTNCFGGSGNGNGRGNGSGGSGNGSGSSSSASPLSPPSAGIGDLNRLYRKSPFMQRKLSNGSHHPHYKYNDESPKKESMFSSIGQSILRNLTTSPFSQKKHNSTATTIPLPHNNQTLITDAATAAAAAATATTPPNIAATVLTTTPTTTPTWRLPTENSQAYDSCDSSSNATTTTLNLGLSSPSPSLPRKQFPTESPTLQLTSQQQQQPQRLQPGNQSPIVLQRFYHQQNQLREKEAAERYQQQRQQPPVGVTSTNPFHSNYVPPPPSTHSTSSQSSTQSTCSQIAINPASISPSSGSGTGNMAGLGIGSAPASGLGAAGHFGAGGTGEQLQYQPLPIAAEATGTSPTLQSRSPEQQSDYGGNGNMVASKLSKLYARRQLLGQSSSSGASNSSLDGCSREQHDAGWFNTLAGAMKRQFATYVKTQLNSTATSPVASSMDRDQEPVHPQPPAYRSVVNNGSGGKSYYYRTLSAASSSSNTSQSTSPTTEPLPGGGTSSFLRRYASSGPGGSISTPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQPPGSPLLHRRYVSASPPLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ DIP protein Q23977 original sequence version: 129 79A2987068EC1870 jip2_mouse C-Jun-amino-terminal kinase-interacting protein 2 Mapk8ip2 Ib2 Jip2 Islet-brain-2 Mitogen-activated protein kinase 8-interacting protein 2 JNK MAP kinase scaffold protein 2 protein protein mouse Mus musculus Mouse MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEMIDDNEEEDDEEEEEEEEEEEDGDRQGKAGGGPGSQALAGDSLIPSPSLEESHKLRPTTLHLTTLGAQDSLNNNNGGFTSAPPSSWQETVLRSPAQEPLKELPAPLLPAEEERHEVQSLARPGCDCEGNQPPEPPASSGGASPSSDPGIEADLRSHSSGGHEGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSGRSSHLTNSIEEASSPASEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMISEGSSPIRCPGQCLSPAPRLPEEAASQANSVPQDCQDPEAGPHVELVDMDTLCGPPPPAPAAPRLGPAQPGPCLFLSNPTRDTITPLWATPGRTARPGRSCSAACSEEEEEDEEEDEEDEEDAEDSVVPPGSRTTGSTAPLDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGNDSEEDSSCEASEEEAGATLLGSDQVPEDASPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCVVNGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVDRFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVSQESMRPVARSVGRAFLEYYQEHLAFACPTEDIYLE 7EC8EAD19A90163C q9vx41_drome X11L Mint CG5678 Dmel\CG5675 Dmint Dmint1 MINT X11 X11-like X11Lalpha dX11 dX11L dX11Lalpha x11 x11Lalpha Dmel_CG5675 CG5675 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSNSCSDSSNESMVNPPHIQMNFGQQAQQQQSHQHQQQQQQQERYVWEMRTRSPNVTPASTVLNSPDLNGELSYVPLQGLSPSGGGVQGSGSYGSNAGRDSGSYYYQRPQLHQIRLGRSPGSQFETRDVLPQGLASPGSPTDVGKADGQCLRDGEIVVFDDIDTNWMNKASSGQRPGSNEDVLKVTKMIGQLPIAEYEGSPRRFGSQPNTNTITMGGPRKRPPGFPQRVSPTTSVANNATAAAKASVGNLIDLVDHEEERSGTLREKTPTFDYLYEFSETRKVLEEFFKANPEDEKRYTDYTTESGDDVASSPQEYPATPMEQAYIGQRLARIPKDELYMVHRSPTKKPPSDQNPSTAYQEHNDIELYIDSNSRSSGDLADTELEANLRRHSRNFTLSPETTDYDSNCGDLDSLSNDINCPTDFGKLYTSMPVLEDGLSSGHASDTENNVSVVCDKQQSSQSQPVHEHNGNGERLENDYNVMSASLATLTTDASQSALISDFASLPMPPAPPPSSPPQIEIADASESMTMVPDADNPLDSHYGAVYAAALGGTHTEKSAGSGLGVTPVTAGGSLPSQAASEIQEAMKEIRSALQRAKTQPEKLKFCDEVLPTDPDSPVWVPRKGTTISTAQGAAADEEPDTDLETDRLLGQQRHDEQDFFADQSLADNNANEGTDIASNGHLNGTSDNNNPNPMNNSKPQTYSTATIRQGIGTSLTPNSPDICQIVGTTDISISSPEKLQFTKSPTGSIKSLKDSANSDKKAKSRNKEGLLEPKVLIEGVLFRARYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKAPEGESQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVPNSVVDPSITSPLGDVPTPGIGEEESPPKEPLSKHNRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGMSLVGLPLSTCQSYIRNAKNQTAVKFTVVPCPPVVEVKILRPKALFQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHDTIVKLLSSSVGEILMKTMPTSMFRLLTGQETPIYI B876C9DCB782AAAB jip1_drome JNK-interacting protein 1 Protein eye developmental SP512 APP-like-interacting protein 1 Aplip1 SP512 CG1200 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADSEFEEFHRPIFEPHTIAGFGSGAGSKKNNPHAFYSLIPNDDLEDSHSSKSDGDGSDQEDGIGLVDHEPKMRQVEDDELGDGLKVTLSSDGSLDTNDSFNSHRHHPLNHQDAIGGFLGMDTSGLGGNSAPVTIGASTDLLAPNTAATRRRRKLPEIPKNKKSSILHLLGGSNFGSLADEFRNGGGGGIPPAVRSGQQRSFLSLKCGYLMDEDSSPDSERMQSLGDVDSGHSTAHSPNDFKSMSPQITSPVSQSPFPPPFGGVPFGQLEMLEATHRGLHKFVPRHHDEIELEIGDAIYVQKEAEDLWCEGVNLRTGRQGIFPSAYAVDLDYNEFDPTVQLVKKERYLLGYLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQRFYQKFIETAYPIEDIYIE 2744E85790EE043F jnk_drome Stress-activated protein kinase JNK bsk JNK CG5680 Protein basket protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTNNRTR 96662B278ABCCA19 s6kl_drome Serine/threonine-protein kinase S6KL S6KL Bin4 Pk17E Protein kinase-like 17E S6 kinase-like protein CG7001 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGNSQPRNASRSRRTSQWPQGAAELGASASDHHYHQEELYQEQQQQQQQPQQEQPSSRRIQFQAHTNQPTQSHPPGDEEQPVQSQQQQLSTWSLGSLSGGRLNWSFSGARNSFRHRNKATRKSLTSLHGSRRGKTQWHRPLTNSIFNSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITHFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLSPREIIARDGIRIYEDRHFDQLTNQCAIDAFLDF 24629C417D601F0F aplip1-appl-1 3 6 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-633445]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 888-888, sequence length 887 [EBI-633445]836-888 13 unspecified role unspecified role prey prey physical association physical association appl-x11l-1 3 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait cytoplasmic region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain physical association physical association pk17e-appl-1 3 6 unspecified role unspecified role bait bait cytoplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-633452]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 888-888, sequence length 887 [EBI-633452]836-888 15 unspecified role unspecified role prey prey physical association physical association appl-aplip1-1 1 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association APLIP1 was expressed as GST fused protein appl-aplip1-2 2 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association aplip1-appl-2 2 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hep-aplip1-1 5 10 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Flag tagged hep and APLIP1 is expressed as a GST-fusion protein. aplip1-aplip1-1 5 13 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association GST-APLIP1 was used to pull down untagged APLIP1. aplip1-hep-1 4 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association FLAG tagged Aplip1 and HA tagged Hep aplip1-aplip1-2 2 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association djnk-hep-1 1 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association GST fused DJNK and FLAG tagged hep were used. djnk-jip1-1 1 8 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association GST tagged DJNK used. app-jip1-1 4 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association APP is FLAG tagged. Mouse JIP1 is HA tagged. app-jip2-1 4 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association APP is FLAG tagged. Mouse JIP2 is HA tagged. app-x11l-1 4 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association APP was FLAG tagged. aplip1-appl-3 3 13 unspecified role unspecified role prey prey c-terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association appl-aplip1-3 3 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association aplip1-klc-1 2 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association jip1-app-1 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association jip2-app-1 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association x11l-app-1 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association