MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. Arch. Biochem. Biophys. (0003-9861) 1999 Finlin BS., Andres DA. no partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Finlin BS., Andres DA. no Arch. Biochem. Biophys. (0003-9861) 1999 partial coverage rapid curation Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. Arch. Biochem. Biophys. (0003-9861) 1999 Finlin BS., Andres DA. no partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Finlin BS., Andres DA. no Arch. Biochem. Biophys. (0003-9861) 1999 partial coverage rapid curation Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. Arch. Biochem. Biophys. (0003-9861) 1999 Finlin BS., Andres DA. no partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Finlin BS., Andres DA. no Arch. Biochem. Biophys. (0003-9861) 1999 partial coverage rapid curation rem2_mouse GTP-binding protein REM 2 Rem2 Rad and Gem-like GTP-binding protein 2 protein protein mouse Mus musculus Mouse MHTDLDTDMDMDTETVALCSSSSRQASPLGTPTPEADTTLLKQKPEKLLAELDLSGPPPAPGVPRRRGSMPVPYKHQLRRAQAVDELDWPPQASPSGSSDSLGSGEAALTQKDGVFKVMLVGESGVGKSTLAGTFGGLQGDHAHEMENSEDTYERRIMVDKEEVTLIVYDIWEQGDAGGWLQDHCLQTGDAFLIVFSVTDRRGFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRGHAGGQRPEPSSPDGPAPPTRRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL mint Binds GTP saturably and exhibits a low intrinsic rate of GTP hydrolysis D7F415A9ABC86125 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63101 original sequence version: 72 2164DF3793B45B7A rem1_mouse GTP-binding protein REM 1 Rem1 Rem Rad and Gem-like GTP-binding protein 1 protein protein mouse Mus musculus Mouse MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL mint Promotes endothelial cell sprouting and actin cytoskeletal reorganization (By similarity). May be involved in angiogenesis. May function in Ca(2+) signaling 4DCFFC50132C8262 rad_mouse GTP-binding protein RAD Rrad protein protein mouse Mus musculus Mouse MTLNGGSGASGSRGAGGRERDRRRGSTPWGPAPPLHRRSMPVDERDLQAALAPGSLATTAAGTRTQGQRLDWPEGSSDSLSSGGSGSEEGVYKVLLLGAPGVGKSALARIFGGIEDGPEAEAAGHTYDRSITVDGEEASLLVYDIWEEDGGCWLPGHCMAMGDAYVIVYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEDNARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 698F0A3BCE605D53 ywhaz-rrad 3 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 7 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction HA-Rad and HA-Rem bind His6-1433zheta but mRem 2 does not in vitro pull down domino mint ywhaz-rem1 3 6 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-372284: original sequence: 18-282 : STPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARR Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction - Pull down His6-1433 zheta, WB anti HA-rem in HEK293 lysatesrnOr HA-Rem pulled down, WB anti 1433rn- as above with deletio of Remrn- alanine scanning of single serines : all the singular mutants still interactrn- HA-Rad binds His6-1433zheta but mRem 2does notrn- Ha-Rem in complex with endogenous level 1433 35S labeledrn domino mint ywhaz-rem1-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-372297: original sequence: 18-282 : STPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARR Stoichiometry: 1.0 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association - Pull down His6-1433 zheta, WB anti HA-rem in HEK293 lysatesrnOr HA-Rem pulled down, WB anti 1433rn- as above with deletio of Remrn- alanine scanning of single serines : all the singular mutants still interactrn- HA-Rad binds His6-1433zheta but mRem 2does notrn- Ha-Rem in complex with endogenous level 1433 35S labeledrn domino mint rem2-ywhaz 1 REM2_MOUSE 4 unspecified role unspecified role unspecified role unspecified role 1433Z_MOUSE 5 unspecified role unspecified role unspecified role unspecified role association association domino mint