MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Evidence for in situ and in vitro association between beta-dystroglycan and the subsynaptic 43K rapsyn protein. Consequence for acetylcholine receptor clustering at the synapse. Evidence for in situ and in vitro association between beta-dystroglycan and the subsynaptic 43K rapsyn protein. Consequence for acetylcholine receptor clustering at the synapse. J. Biol. Chem. (0021-9258) 1998 Cartaud A., Coutant S., Petrucci TC., Cartaud J. no in vivo in vivo crosslink cross-linking study crosslink predetermined predetermined participant predetermined Cartaud A., Coutant S., Petrucci TC., Cartaud J. no J. Biol. Chem. (0021-9258) 1998 Evidence for in situ and in vitro association between beta-dystroglycan and the subsynaptic 43K rapsyn protein. Consequence for acetylcholine receptor clustering at the synapse. Evidence for in situ and in vitro association between beta-dystroglycan and the subsynaptic 43K rapsyn protein. Consequence for acetylcholine receptor clustering at the synapse. J. Biol. Chem. (0021-9258) 1998 Cartaud A., Coutant S., Petrucci TC., Cartaud J. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cartaud A., Coutant S., Petrucci TC., Cartaud J. no J. Biol. Chem. (0021-9258) 1998 Evidence for in situ and in vitro association between beta-dystroglycan and the subsynaptic 43K rapsyn protein. Consequence for acetylcholine receptor clustering at the synapse. Evidence for in situ and in vitro association between beta-dystroglycan and the subsynaptic 43K rapsyn protein. Consequence for acetylcholine receptor clustering at the synapse. J. Biol. Chem. (0021-9258) 1998 Cartaud A., Coutant S., Petrucci TC., Cartaud J. no in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Cartaud A., Coutant S., Petrucci TC., Cartaud J. no J. Biol. Chem. (0021-9258) 1998 rapsn_tetcf 43 kDa receptor-associated protein of the synapse RAPSN Acetylcholine receptor-associated 43 kDa protein 43 kDa postsynaptic protein protein protein tetcf Torpedo californica (Pacific electric ray) Pacific electric ray Torpedo californica MGQDQTKQQIEKGLQLYQANETGKALEIWQQVVERSTELPGRFRALGCLITAHSEMGKYEDMLRFAVAQSEAARQMGDPERVTEAYLNLARGHEKLCEFSEAVAYCRTCLGAEGGPLRLQFNGQVCLSMGNAFLGLSAFQKALECFEKALRYAHGNDDKMLECRVCCSLGAFYVQLKDYEKALFFPCKSAELVADYGRGWSLKYKAMSRYHMAAAYRKLGRMDDAMECCEESMKIALQHQDRPLQALCLLCFADIHRHRSDIGKALPRYESSLNIMTEIGNRLGQAHVLLNIAKCWMTEKKLDKTLGVVQKAEELADAVGNKLVLLKAHCLYETIYREMGSDQLLRDHVVKFHECMEDMELYCGLCGESIGDQNSQLQALPCSHLFHLKCLQTNGNRGCPNCKRSSVKPGYV mint Thought to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin C0BAE696ADFB2DFA dag1_rabit Dystroglycan 1 DAG1 Dystrophin-associated glycoprotein 1 Dystroglycan protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MRMSVGLSLLLPLWGRTFLLLLCVAVAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEALPTVVGIPDGTAVVGRSFRVTIPTDLIGSSGEVIKVSTAGKEVLPSWLHWDPQSHTLEGLPLDTDKGVHYISVSAAQLDANGSHIPQTSSVFSIEVYPEDHSEPQSVRAASPDLGEAAASACAAEEPVTVLTVILDADLTKMTPKQRIDLLHRMQSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGTMSAQLGYPVVGWHIANKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTTRTRGAIIQTPTLGPIQPTRVSDAGTVVSGQIRATVTIPGYVEPTAVATPPTTTTKKPRVSTPKPATPSTDSSATTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDKAPARFKAKFVGDPAPVVNDIHKKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWTNNTLPLEPCPKEQITGLSRRIAEDNGQPRPAFTNALEPDFKATSIAITGSGSCRHLQFIPVAPPGIPSSVTPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPSQSVPETTPLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP mint Forms part of the dystrophin-associated protein complex (DAPC) which may link the cytoskeleton to the extracellular matrix C2B9E4733A0AB82A dag1-rapsn 1 4 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain JUXTA MEMBRANE REGION range MINT-1534362: original sequence: 787-819 : DQATFIKKGVPIIFADELDDSKPPPSSSMPLI Stoichiometry: 1.0 physical association physical association mint dag1-rapsn-1 3 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain JUXTA MEMBRANE REGION range MINT-1534377: original sequence: 787-819 : DQATFIKKGVPIIFADELDDSKPPPSSSMPLI Stoichiometry: 1.0 direct interaction direct interaction mint dag1-rapsn-2 2 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain JUXTA MEMBRANE REGION range MINT-1534390: original sequence: 787-819 : DQATFIKKGVPIIFADELDDSKPPPSSSMPLI Stoichiometry: 1.0 direct interaction direct interaction mint