MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Multiple WW domains, but not the C2 domain, are required for inhibition of the epithelial Na+ channel by human Nedd4. Multiple WW domains, but not the C2 domain, are required for inhibition of the epithelial Na+ channel by human Nedd4. J. Biol. Chem. (0021-9258) 2001 imex curation Snyder PM., Olson DR., McDonald FJ., Bucher DB. psynder@blue.uiowa.edu Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Snyder PM., Olson DR., McDonald FJ., Bucher DB. psynder@blue.uiowa.edu J. Biol. Chem. (0021-9258) 2001 IMEx Multiple WW domains, but not the C2 domain, are required for inhibition of the epithelial Na+ channel by human Nedd4. Multiple WW domains, but not the C2 domain, are required for inhibition of the epithelial Na+ channel by human Nedd4. J. Biol. Chem. (0021-9258) 2001 imex curation Snyder PM., Olson DR., McDonald FJ., Bucher DB. psynder@blue.uiowa.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Snyder PM., Olson DR., McDonald FJ., Bucher DB. psynder@blue.uiowa.edu J. Biol. Chem. (0021-9258) 2001 IMEx nedd4_human E3 ubiquitin-protein ligase NEDD4 Neural precursor cell expressed developmentally down-regulated protein 4 NEDD4 KIAA0093 NEDD4-1 Cell proliferation-inducing gene 53 protein PIG53 HECT-type E3 ubiquitin transferase NEDD4 protein protein human Homo sapiens Human MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAPLIKENVQSQERSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKDGIYSSAVVDNELNAVNDGHLVSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLGGAYPNISCLSSLKHNCSKGGPSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEERTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD DIP protein P46934 original sequence version: 76 D56EBBC50A34F13B scnna_human Amiloride-sensitive sodium channel subunit alpha SCNN1A SCNN1 Epithelial Na(+) channel subunit alpha Nonvoltage-gated sodium channel 1 subunit alpha SCNEA Alpha-NaCH protein protein human Homo sapiens Human MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFEFFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP mint Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception Defects in SCNN1A are a cause of autosomal recessive pseudohypoaldosteronism type 1 (PHA1) [MIM:264350]. PHA1 is a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. There are 2 forms of PHA1: the autosomal recessive form that is severe, and the dominant form which is more milder and due to defects in mineralocorticoid receptor. Autosomal recessive PHA1 is characterized by an often fulminant presentation in the neonatal period with dehydration, hyponatraemia, hyperkalaemia, metabolic acidosis, failure to thrive and weight loss 2CCF342E7DF32E72 scnnb_human Amiloride-sensitive sodium channel subunit beta SCNN1B Epithelial Na(+) channel subunit beta SCNEB Nonvoltage-gated sodium channel 1 subunit beta Beta-NaCH protein protein human Homo sapiens Human MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI 5249867F0A960E0C scnng_human Amiloride-sensitive sodium channel subunit gamma SCNN1G Epithelial Na(+) channel subunit gamma SCNEG Nonvoltage-gated sodium channel 1 subunit gamma Gamma-NaCH protein protein human Homo sapiens Human MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAANYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVFFIDFFSIIARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDDDLPTFNSALHLPPALGTQVPGTPPPKYNTLRLERAFSNQLTDTQMLDEL F67ED45F03A9BF3F nedd4-scnn1b-2 1 5 unspecified role unspecified role prey prey purified purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro Stoichiometry: 1.0 3 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-577727: original sequence: 420-458 : SNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEK region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction Fig. 4B Other technique: overlay assay homomint domino mint nedd4-scnn1a-2 1 4 unspecified role unspecified role prey prey purified purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro Stoichiometry: 1.0 3 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-577741: original sequence: 347-385 : RRQISEETESVDNQESSENWEIIREDEATMYSSQAFPS region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 4B Other technique: Overlay assay homomint domino mint nedd4-scnn1g-1 1 6 unspecified role unspecified role prey prey purified purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro Stoichiometry: 1.0 3 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-577701: original sequence: 473-511 : TTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQ region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction Fig. 4B Other technique: overlay assay homomint domino mint scnn1a-nedd4-1 2 4 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 Stoichiometry: 1.0 3 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain range MINT-577717: original sequence: 114-927 : DEENSRIVRVRVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETESVDNQESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEERTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQF [EBI-7845590]The shifted ranges (114-927) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7845590]114-927 [EBI-7845590]P46934,3 P46934:p.[Val629Trp;His631Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain V W Wed Sep 16 10:42:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val629Trp;His631Gly]' P46934:p.[Ile911Trp;His913Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G Wed Sep 16 11:18:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile911Trp;His913Gly]' P46934:p.[Val629Trp;His631Gly;Val786Trp;His788Gly;Ile911Trp;His913Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G Fri Sep 18 23:41:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val629Trp;His631Gly;Val786Trp;His788Gly;Ile911Trp;His913Gly]' P46934:p.[Val629Trp;His631Gly;Val786Trp;His788Gly;Ile859Trp;His861Gly] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G Wed Sep 16 10:24:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val629Trp;His631Gly;Val786Trp;His788Gly;Ile859Trp:His861Gly]' P46934:p.[Val786Trp;His788Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G Wed Sep 16 10:54:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val786Trp;His788Gly]' P46934:p.[Ile859Trp;His861Gly] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W Wed Sep 16 09:52:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile859Trp:His861Gly]' P46934:p.[Val629Trp;His631Gly;Val786Trp;His788Gly;Ile859Trp;His861Gly;Ile911Trp;His913Gly] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G Wed Sep 16 10:07:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val629Trp;His631Gly;Val786Trp;His788Gly;Ile859Trp:His861Gly;Ile911Trp;His913Gly]' P46934:p.[Val786Trp;His788Gly;Ile859Trp;His861Gly;Ile911Trp;His913Gly] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G Wed Sep 16 09:50:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val786Trp;His788Gly;Ile859Trp:His861Gly;Ile911Trp;His913Gly]' P46934:p.[Val629Trp;His631Gly;Ile859Trp;His861Gly;Ile911Trp;His913Gly] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G certain certain sequence position certain certain certain sequence position certain I W certain certain sequence position certain certain certain sequence position certain H G Wed Sep 16 10:08:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val629Trp;His631Gly;Ile859Trp:His861Gly;Ile911Trp;His913Gly]' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction Fig. 5 homomint mint