MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2. Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 Poelzl G., Kasai Y., Mochizuki N., Shaul PW., Brown M., Mendelsohn ME. no in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Poelzl G., Kasai Y., Mochizuki N., Shaul PW., Brown M., Mendelsohn ME. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2. Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 Poelzl G., Kasai Y., Mochizuki N., Shaul PW., Brown M., Mendelsohn ME. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Poelzl G., Kasai Y., Mochizuki N., Shaul PW., Brown M., Mendelsohn ME. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 q9jm97_mouse ERb protein protein mouse Mus musculus Mouse MSICASSHKDFSQLRPTQDMEIKNSPSSLTSPASYNCSQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEHTLPVN fragmentation type: fragment mint 4703615AE8593DAB md2l1_mouse Mitotic spindle assembly checkpoint protein MAD2A Mad2l1 Mad2a Mitotic arrest deficient 2-like protein 1 protein protein mouse Mus musculus Mouse MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPELIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEEVRLRSFTTTIHKVNSMVAYKTPVND A9F3F28BC4C9738E esr2-mad2l1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint esr2-mad2l1-1 2 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint