MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Isolation of a ribonucleoprotein complex involved in mRNA localization in Drosophila oocytes. Isolation of a ribonucleoprotein complex involved in mRNA localization in Drosophila oocytes. J. Cell Biol. (0021-9525) 2000 Wilhelm JE., Mansfield J., Hom-Booher N., Wang S., Turck CW., Hazelrigg T., Vale RD. no in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Wilhelm JE., Mansfield J., Hom-Booher N., Wang S., Turck CW., Hazelrigg T., Vale RD. no J. Cell Biol. (0021-9525) 2000 Isolation of a ribonucleoprotein complex involved in mRNA localization in Drosophila oocytes. Isolation of a ribonucleoprotein complex involved in mRNA localization in Drosophila oocytes. J. Cell Biol. (0021-9525) 2000 Wilhelm JE., Mansfield J., Hom-Booher N., Wang S., Turck CW., Hazelrigg T., Vale RD. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Wilhelm JE., Mansfield J., Hom-Booher N., Wang S., Turck CW., Hazelrigg T., Vale RD. no J. Cell Biol. (0021-9525) 2000 q95re4_drome yps Dmel\CG5654 YPS Yps p45 p57 Dmel_CG5654 CG5654 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAAPIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQPRRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRDGGEYIQGQGPPRPQQPRPRRQRKPNGPGGGSEQQPEKNGAQELQNTTTESTA 0AB3504FECCC6AE6 exu_drome Maternal protein exuperantia exu CG8994 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVADNIDAGVAIAVADQSSSPVGDKVELPAGNYILVGVDIDTTGRRLMDEIVQLAAYTPTDHFEQYIMPYMNLNPAARQRHQVRVISIGFYRMLKSMQTYKIIKSKSEIAALKDFLNWLEQLKTKAGPSSDGIVLIYHEERKFIPYMILESLKKYGLLERFTASVKSFANSINLAKASIGDANIKNYSLRKLSKILSTTKEEDAACSASTSGSGSGLGSGSSMVSDSVSISPRDSTVTNGDDKQSSKNAVQGKRELFDGNASVRAKLAFDVALQLSNSDGKPEPKSSEALENMFNAIRPFAKLVVSDVLELDIQIENLERQNSFRPVFLNYFKTTLYHRVRAVKFRIVLAENGFDLNTLSAIWAEKNIEGLDIALQSIGRLKSKDKAELLELLDSYFDPKKTTVKPVVKGNSNNNNNYRRRNRRGGRQSVKDARPSSSPSASTEFGAGGDKSRSVSSLPDSTTKTPSPNKPRMHRKRNSRQSLGATPNGLKVAAEISSSGVSELNNSAPPAVTISPVVAQPSPTPVAITASN 50BD15B712A62C4E exu-yps 1 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-382967: original sequence: 1-160 : MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRK Stoichiometry: 1.0 physical association physical association The Exu-Yps complex contains oskar mRNA. mint exu-yps-1 2 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-382981: original sequence: 1-160 : MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRK Stoichiometry: 1.0 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association The Exu-Yps complex contains oskar mRNA. mint exu-yps-2 1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-382997: original sequence: 1-160 : MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRK Stoichiometry: 1.0 colocalization colocalization The Exu-Yps complex contains oskar mRNA. mint