MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phosphorylation of sic1, a cyclin-dependent kinase (Cdk) inhibitor, by Cdk including Pho85 kinase is required for its prompt degradation. Phosphorylation of sic1, a cyclin-dependent kinase (Cdk) inhibitor, by Cdk including Pho85 kinase is required for its prompt degradation. Mol. Biol. Cell (1059-1524) 1998 Nishizawa M., Kawasumi M., Fujino M., Toh-e A. no mas@mc.med.keio.ac.jp in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nishizawa M., Kawasumi M., Fujino M., Toh-e A. no mas@mc.med.keio.ac.jp Mol. Biol. Cell (1059-1524) 1998 pho85_yeast Cyclin-dependent protein kinase PHO85 PHO85 SSG3 P7102.18A Serine/threonine-protein kinase PHO85 Negative regulator of the PHO system YPL031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYHHAS 246A4358870B00EC 246A4358870B00EC sic1_yeast Protein SIC1 SIC1 SDB25 YLR079W L9449.8 CDK inhibitor p40 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTPSTPPRSRGTRYLAQPSGNTSSSALMQGQKTPQKPSQNLVPVTPSTTKSFKNAPLLAPPNSNMGMTSPFNGLTSPQRSPFPKSSVKRTLFQFESHDNGTVREEQEPLGRVNRILFPTQQNVDIDAAEEEEEGEVLLPPSRPTSARQLHLSLERDEFDQTHRKKIIKDVPGTPSDKVITFELAKNWNNNSPKNDARSQESEDEEDIIINPVRVGKNPFASDELVTQEIRNERKRAMLRENPDIEDVITYVNKKGEVVEKRRLTDEEKRRFKPKALFQSRDQEH 7913636340678F78 7913636340678F78 sic1-pho85 1 3 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 2 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation mint