MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of a novel interaction between integrin beta1 and 14-3-3beta. Identification of a novel interaction between integrin beta1 and 14-3-3beta. Oncogene (0950-9232) 2001 rapid curation Han DC., Rodriguez LG., Guan JL. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Han DC., Rodriguez LG., Guan JL. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2001 partial coverage rapid curation rapid curation Identification of a novel interaction between integrin beta1 and 14-3-3beta. Identification of a novel interaction between integrin beta1 and 14-3-3beta. Oncogene (0950-9232) 2001 rapid curation Han DC., Rodriguez LG., Guan JL. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Han DC., Rodriguez LG., Guan JL. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2001 partial coverage rapid curation rapid curation Identification of a novel interaction between integrin beta1 and 14-3-3beta. Identification of a novel interaction between integrin beta1 and 14-3-3beta. Oncogene (0950-9232) 2001 rapid curation Han DC., Rodriguez LG., Guan JL. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Han DC., Rodriguez LG., Guan JL. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2001 partial coverage rapid curation rapid curation Identification of a novel interaction between integrin beta1 and 14-3-3beta. Identification of a novel interaction between integrin beta1 and 14-3-3beta. Oncogene (0950-9232) 2001 rapid curation Han DC., Rodriguez LG., Guan JL. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Han DC., Rodriguez LG., Guan JL. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2001 partial coverage rapid curation rapid curation 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 itb1_chick Integrin beta-1 ITGB1 CSAT antigen JG22 antigen RGD-receptor protein protein chick Gallus gallus (Chicken) Chicken MAETNLTLLTWAGILCCLIWSGSAQQGGSDCIKANAKSCGECIQAGPNCGWCKKTDFLQEGEPTSARCDDLAALKSKGCPEQDIENPRGSKRVLEDREVTNRKIGAAEKLKPEAITQIQPQKLVLQLRVGEPQTFSLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTALMREMEKITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTSEGNKFNELVGKQHISGNLDSPEGGFDAIMQVAVCGDQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQAVYKELKNLIPKSAVGTLSSNSSNVIQLIIDAYNSLSSEVILENSKLPKEVTISYKSYCKNGVNDTQEDGRKCSNISIGDEVRFEINVTANECPKKGQNETIKIKPLGFTEEVEIHLQFICDCLCQSEGEPNSPACHDGNGTFECGACRCNEGRIGRLCECSTDEVNSEDMDAYCRRENSTEICSNNGECICGQCVCKKRENTNEVYSGKYCECDNFNCDRSNGLICGGNGICKCRVCECFPNFTGSACDCSLDTTPCMAGNGQICNGRGTCECGTCNCTDPKFQGPTCEMCQTCLGVCAEHKDCVQCRAFEKGEKKETCSQECMHFNMTRVESRGKLPQPVHPDPLSHCKEKDVGDCWFYFTYSVNSNGEASVHVVETPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK 2F6FEFCDF2C80457 itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK DIP protein P05556 original sequence version: 139 DIP protein P05556-1 original sequence version: 143 DIP protein P05556 original sequence version: 154 DIP protein P05556 original sequence version: 167 DE35979C1625578C itgb1-ywhab 3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-576469: original sequence: 776-790 : MNAKWDTGENPIYK Stoichiometry: 1.0 colocalization colocalization 14-3-3 binds C terminus of integrin beta 1 (aa 776-790) in a phosphorylation indipendent manner. The two proteins co-localized only during the early stage of cell spreading on fibronectin. mint ywhab-itgb1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-576485: original sequence: 776-790 : MNAKWDTGENPIYK Stoichiometry: 1.0 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association 14-3-3 binds C terminus of integrin beta 1 (aa 776-790) in a phosphorylation indipendent manner. The two proteins co-localized only during the early stage of cell spreading on fibronectin. mint ywhab-itgb1-1 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-576502: original sequence: 776-790 : MNAKWDTGENPIYK Stoichiometry: 1.0 physical association physical association 14-3-3 binds C terminus of integrin beta 1 (aa 776-790) in a phosphorylation indipendent manner. The two proteins co-localized only during the early stage of cell spreading on fibronectin. mint itgb1-ywhab-1 4 1433B_HUMAN 5 unspecified role unspecified role unspecified role unspecified role ITB1_HUMAN 7 unspecified role unspecified role unspecified role unspecified role physical association physical association homomint domino mint