MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Biochemical identification of Xenopus Pumilio as a sequence-specific cyclin B1 mRNA-binding protein that physically interacts with a Nanos homolog, Xcat-2, and a cytoplasmic polyadenylation element-binding protein. Biochemical identification of Xenopus Pumilio as a sequence-specific cyclin B1 mRNA-binding protein that physically interacts with a Nanos homolog, Xcat-2, and a cytoplasmic polyadenylation element-binding protein. J. Biol. Chem. (0021-9258) 2001 Nakahata S., Katsu Y., Mita K., Inoue K., Nagahama Y., Yamashita M. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nakahata S., Katsu Y., Mita K., Inoue K., Nagahama Y., Yamashita M. no J. Biol. Chem. (0021-9258) 2001 Biochemical identification of Xenopus Pumilio as a sequence-specific cyclin B1 mRNA-binding protein that physically interacts with a Nanos homolog, Xcat-2, and a cytoplasmic polyadenylation element-binding protein. Biochemical identification of Xenopus Pumilio as a sequence-specific cyclin B1 mRNA-binding protein that physically interacts with a Nanos homolog, Xcat-2, and a cytoplasmic polyadenylation element-binding protein. J. Biol. Chem. (0021-9258) 2001 Nakahata S., Katsu Y., Mita K., Inoue K., Nagahama Y., Yamashita M. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Nakahata S., Katsu Y., Mita K., Inoue K., Nagahama Y., Yamashita M. no J. Biol. Chem. (0021-9258) 2001 cpe1a_xenla Cytoplasmic polyadenylation element-binding protein 1-A 58 kDa CPE-binding protein cpeb1-a cpeb protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAFPLKDDLGRAKDCWGCPSDTPALSTCSNADIFRRINAMLDNSLDFTGVCTTPNTKGKCEHLQDYQDTEGPAASRMLFSTSHEPLPRGLPDTNDLCLGLQSLSLTGWDRPWSTQDSEAGGHSSTPTAAQSVFSMLNSPMGKPSPLGFLTFDPIGSDLMEKYPTPLLRSSRLDSRSILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLPLGGGVSRDPLKLGIGSRLDQDHAALAAATVSPLGITKGWPSTSVWPSWDLLDSAEDPFSIEREARLHRQAAAVNEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKGYVYLVFESEKSVRALLQACSQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWHWQHSMEILRHHRPLMRNQKSRDSS EF812949F5B4DE54 EF812949F5B4DE54 nano1_xenla Nanos homolog 1 nanos1 Xcat-2 protein xcat-2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDGGLCFDSWSDYLGLSSLISRGLQPQREGERPRWDVLSPASAEPLPSNESVGHKGCGFCRSNREALSLYTSHRLRALDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPLRRLLRDPQSNSNNPKLRH mint D842849EA021CDFD q9deb9_xenla protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MFRQMGPQQQQQQQQQQHQQQQQPNANLHSNSFYGNSTMSNNSQSSSLFSPGPGQPGSTSLGFGSSNPLGAAIGSAFGGFGSSVGNSAGSSGSRRDSLSASCDLYKRSSSSLAAIGQPYYNSLGFSSSPSPIGMPLPSQTSGHSLTPPPSLSSHGSSSSLHLGGLTSGSGRYISAAPGAEAKYRSAANTSSFFSSNSQLFPPSRQRYNRADIMPSGRSRLLEDFRNNRFPNLQLRDLMGHIVEFSQDQHGSRFIQQKLERASPAERQLVFNEILQAAYQLMVDVIGNYVIQKFFEFGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPPDQQVINEMVRELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKSQVFALSTHPYGCRVIQRILEHCLPEQTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAMLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPAQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGMDLGPMCGPSNGII fragmentation type: fragment mint 8ACAB122861B5F8E q9deb9-nanos1 1 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction mint q9deb9-cpeb1_a 1 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 3 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction mint q9deb9-nanos1-1 2 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association mint