MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2. Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2. FEBS Lett. (0014-5793) 2001 Jin C., Ugai H., Song J., Murata T., Nili F., Sun K., Horikoshi M., Yokoyama KK. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Jin C., Ugai H., Song J., Murata T., Nili F., Sun K., Horikoshi M., Yokoyama KK. no FEBS Lett. (0014-5793) 2001 Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2. Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2. FEBS Lett. (0014-5793) 2001 Jin C., Ugai H., Song J., Murata T., Nili F., Sun K., Horikoshi M., Yokoyama KK. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Jin C., Ugai H., Song J., Murata T., Nili F., Sun K., Horikoshi M., Yokoyama KK. no FEBS Lett. (0014-5793) 2001 Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2. Identification of mouse Jun dimerization protein 2 as a novel repressor of ATF-2. FEBS Lett. (0014-5793) 2001 Jin C., Ugai H., Song J., Murata T., Nili F., Sun K., Horikoshi M., Yokoyama KK. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Jin C., Ugai H., Song J., Murata T., Nili F., Sun K., Horikoshi M., Yokoyama KK. no FEBS Lett. (0014-5793) 2001 atf2_mouse Cyclic AMP-dependent transcription factor ATF-2 Atf2 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 MXBP protein protein protein mouse Mus musculus Mouse MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPSQAQPSGS F9CDEC3BC3119ACB jdp2_human Jun dimerization protein 2 JDP2 protein protein human Homo sapiens Human MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK 29C576AF2C574BA8 jdp2-atf2 2 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-468864: original sequence: 3-68 : PGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSE Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-468870: original sequence: 340-415 : FLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTA Stoichiometry: 1.0 direct interaction direct interaction The protein that interacts with ATF-2 is a mouse protein homologous to rat JDP2. Neither protein is at the moment in S.P.. The entry refers to a fragment of human JDP2 protein homomint mint jdp2-atf2-1 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-468881: original sequence: 3-68 : PGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSE Stoichiometry: 1.0 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-468887: original sequence: 340-415 : FLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTA Stoichiometry: 1.0 physical association physical association The protein that interacts with ATF-2 is a mouse protein homologous to rat JDP2. Neither protein is at the moment in S.P.. The entry refers to a fragment of human JDP2 protein homomint mint jdp2-atf2-2 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-468898: original sequence: 3-68 : PGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSE Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-468907: original sequence: 340-415 : FLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTA tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association The protein that interacts with ATF-2 is a mouse protein homologous to rat JDP2. Neither protein is at the moment in S.P.. The entry refers to a fragment of human JDP2 protein homomint mint