MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. EMBO J. (0261-4189) 2001 imex curation Holm M., Hardtke CS., Gaudet R., Deng XW. xingwang.deng@yale.edu An arabidopsis lambda ACT expression cDNA library was obtained from the Arabidopsis Biological Resource Center and converted to a pACT library prior to screening. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Holm M., Hardtke CS., Gaudet R., Deng XW. xingwang.deng@yale.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). An arabidopsis lambda ACT expression cDNA library was obtained from the Arabidopsis Biological Resource Center and converted to a pACT library prior to screening. EMBO J. (0261-4189) 2001 IMEx Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. EMBO J. (0261-4189) 2001 imex curation Holm M., Hardtke CS., Gaudet R., Deng XW. xingwang.deng@yale.edu An arabidopsis lambda ACT expression cDNA library was obtained from the Arabidopsis Biological Resource Center and converted to a pACT library prior to screening. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Holm M., Hardtke CS., Gaudet R., Deng XW. A directed yeast two hybrid assay was used in this study. Figure 1. Figure 5 and Figure 6. xingwang.deng@yale.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). An arabidopsis lambda ACT expression cDNA library was obtained from the Arabidopsis Biological Resource Center and converted to a pACT library prior to screening. EMBO J. (0261-4189) 2001 IMEx hy5_arath Transcription factor HY5 HY5 BZIP56 At5g11260 F2I11_150 Protein LONG HYPOCOTYL 5 bZIP transcription factor 56 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRESGSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL 1E3C4672B192D8A9 q96288-1 B-box zinc finger protein 24 BBX24 STO Salt tolerance protein T21E18.8 T21E18.9 At1g06040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDICQEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQPEPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHFSDIESTDKKGQLDLGAGELDWFSDMGFFGDQINDKALPAAEVPELSVSHLGHVHSYKPMKSNVSHKKPRFETRYDDDDEEHFIVPDLG 4E7A960D56741B0A cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA DIP protein P43254 original sequence version: 138 DIP protein P43254 original sequence version: 113 DIP protein P43254 original sequence version: 114 E6D9A1B702EAE8F0 bbx25_arath B-box zinc finger protein 25 BBX25 Protein SALT TOLERANCE HOMOLOG 1 STH STH1 Salt tolerance-like protein T28P16.13 At2g31380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIQCDVCEKAPATLICCADEAALCAKCDVEVHAANKLASKHQRLFLDSLSTKFPPCDICLEKAAFIFCVEDRALLCRDCDEATHAPNTRSANHQRFLATGIRVALSSTSCNQEVEKNHFDPSNQQSLSKPPTQQPAAPSPLWATDEFFSYSDLDCSNKEKEQLDLGELDWLAEMGLFGDQPDQEALPVAEVPELSFSHLAHAHSYNRPMKSNVPNKKQRLEYRYDDEEEHFLVPDLG 1088617F55A003AF cop1-sto-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association cop1-sth-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association hy5-cop1-8 2 5 unspecified role unspecified role prey prey P43254:p.Lys422Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:46:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys422glu' Tue Jun 30 16:31:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys422Glu' P43254:p.Lys550Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:44:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys550glu' Tue Jun 30 18:10:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys550Glu' P43254:p.Trp467Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:03:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp467ala' Tue Jun 30 16:56:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp467Ala' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P43254:p.Gly524Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Wed May 02 17:41:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly524glu' Tue Jun 30 19:28:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly524Glu' P43254:p.Glu592Arg mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Wed May 02 18:52:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu592arg' Tue Jun 30 18:25:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu592Arg' 3 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O24646:p.Val43_Pro44delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain VP AA Fri Jul 22 10:56:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val43ala,pro44ala' Wed May 02 14:29:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro43-44ala_ala' Tue Jun 30 16:53:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val43_Pro44delinsAlaAla' physical association physical association sto-cop1-1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P43254:p.Gly524Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Wed May 02 19:30:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly524glu' Tue Jun 30 17:38:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly524Glu' P43254:p.Lys422Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:18:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys422glu' Tue Jun 30 19:18:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys422Glu' P43254:p.Arg465Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 18:04:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg465glu' Tue Jun 30 15:36:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg465Glu' P43254:p.Trp467Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 17:56:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp467ala' Tue Jun 30 19:10:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp467Ala' P43254:p.Lys550Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:08:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys550glu' Tue Jun 30 18:37:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys550Glu' P43254:p.Glu592Arg mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Wed May 02 20:11:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu592arg' Tue Jun 30 17:46:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu592Arg' physical association physical association sth-cop1-2 2 6 unspecified role unspecified role bait bait Q9SID1:p.[Val234Ala;Pro235Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:43:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val234ala,pro235ala' Tue Jun 30 17:35:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val234Ala;Pro235Ala]' 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P43254:p.Gly524Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Wed May 02 17:43:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly524glu' Tue Jun 30 16:09:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly524Glu' P43254:p.Arg465Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 16:50:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg465glu' Tue Jun 30 19:47:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg465Glu' P43254:p.Trp467Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 18:52:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp467ala' Tue Jun 30 16:53:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp467Ala' P43254:p.Lys422Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:08:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys422glu' Tue Jun 30 20:12:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys422Glu' P43254:p.Lys550Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:42:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys550glu' Tue Jun 30 16:50:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys550Glu' P43254:p.Glu592Arg mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Wed May 02 20:23:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu592arg' Tue Jun 30 18:36:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu592Arg' physical association physical association sth-cop1-1 2 6 unspecified role unspecified role bait bait Q9SID1:p.Asp236Lys mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D K Wed May 02 17:10:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp236lys' Tue Jun 30 19:04:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp236Lys' 5 unspecified role unspecified role prey prey P43254:p.Lys550Glu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 18:57:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys550glu' Tue Jun 30 18:18:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys550Glu' physical association physical association This interaction demonstrated the probable formation of a salt bridge between COP1 lysine (550) residue and STH aspartic acid (236) residue. hy5-cop1-1 2 5 unspecified role unspecified role prey prey P43254:p.Lys550Glu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:29:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys550glu' Tue Jun 30 17:15:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys550Glu' 3 unspecified role unspecified role bait bait O24646:p.Glu45Lys mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 20:24:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu45lys' Tue Jun 30 16:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu45Lys' physical association physical association This interaction demonstrated the probable formation of a salt bridge between COP1 lysine (550) residue and HY5 glutamic acid acid (45) residue. hy5-cop1-2 2 5 unspecified role unspecified role prey prey P43254:p.Lys550Glu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:41:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys550glu' Tue Jun 30 17:23:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys550Glu' 3 unspecified role unspecified role bait bait O24646:p.Glu45Arg mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Wed May 02 18:00:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu45arg' Tue Jun 30 19:16:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu45Arg' physical association physical association This interaction demonstrated the probable formation of a salt bridge between COP1 lysine (550) residue and HY5 glutamic acid acid (45) residue.