MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation. Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation. J. Cell Biol. (0021-9525) 2000 Mah AL., Perry G., Smith MA., Monteiro MJ. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mah AL., Perry G., Smith MA., Monteiro MJ. no J. Cell Biol. (0021-9525) 2000 Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation. Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation. J. Cell Biol. (0021-9525) 2000 Mah AL., Perry G., Smith MA., Monteiro MJ. no human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Mah AL., Perry G., Smith MA., Monteiro MJ. no J. Cell Biol. (0021-9525) 2000 Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation. Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation. J. Cell Biol. (0021-9525) 2000 Mah AL., Perry G., Smith MA., Monteiro MJ. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Mah AL., Perry G., Smith MA., Monteiro MJ. no J. Cell Biol. (0021-9525) 2000 psn2_human Presenilin-2 PSEN2 AD4 PS2 PSNL2 STM2 STM-2 E5-1 AD3LP AD5 protein protein human Homo sapiens Human MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI A927EEC623468116 psn1_human Presenilin-1 PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI DIP protein P49768 original sequence version: 106 DIP protein P49768-1 original sequence version: 144 DIP protein P49768 original sequence version: 186 5E0F451EF82BCF20 ubql1_human Ubiquilin-1 Protein linking IAP with cytoskeleton 1 UBQLN1 DA41 PLIC1 protein protein human Homo sapiens Human MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS 8B4756B6113B7025 ubqln1-psen2 3 4 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433898: original sequence: 270-319 : PKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLP Stoichiometry: 1.0 6 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433892: original sequence: 542-585 : NPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLL Stoichiometry: 1.0 direct interaction direct interaction homomint mint ubqln1-psen1 3 5 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433953: original sequence: 264-315 : PKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSK Stoichiometry: 1.0 6 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433947: original sequence: 542-585 : NPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLL Stoichiometry: 1.0 direct interaction direct interaction homomint mint ubqln1-psen1-1 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433928: original sequence: 542-585 : NPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433937: original sequence: 264-315 : PKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint ubqln1-psen2-1 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433979: original sequence: 542-585 : NPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLL Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433988: original sequence: 270-319 : PKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLP tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint psen2-ubqln1 2 UBQLN1 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 PS2 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-433917: original sequence: 270-319 : PKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLP Stoichiometry: 1.0 colocalization colocalization F7 homomint mint psen1-ubqln1 2 UBQLN1 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component fixed cell fixed cell Stoichiometry: 1.0 PS1 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F7 homomint mint