MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Hrs interacts with SNAP-25 and regulates Ca(2+)-dependent exocytosis. Hrs interacts with SNAP-25 and regulates Ca(2+)-dependent exocytosis. J. Cell. Sci. (0021-9533) 2000 Kwong J., Roundabush FL., Hutton Moore P., Montague M., Oldham W., Li Y., Chin LS., Li L. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kwong J., Roundabush FL., Hutton Moore P., Montague M., Oldham W., Li Y., Chin LS., Li L. no J. Cell. Sci. (0021-9533) 2000 Hrs interacts with SNAP-25 and regulates Ca(2+)-dependent exocytosis. Hrs interacts with SNAP-25 and regulates Ca(2+)-dependent exocytosis. J. Cell. Sci. (0021-9533) 2000 Kwong J., Roundabush FL., Hutton Moore P., Montague M., Oldham W., Li Y., Chin LS., Li L. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kwong J., Roundabush FL., Hutton Moore P., Montague M., Oldham W., Li Y., Chin LS., Li L. no J. Cell. Sci. (0021-9533) 2000 snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 hgs_rat Hepatocyte growth factor-regulated tyrosine kinase substrate Hgs Hrs Hrs2 SNAP-25-interacting protein Hrs-2 protein protein rat Rattus norvegicus (Rat) Rat MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKAASTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSTYTAHPKSEPAPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMVEAPLPETDSQPITSCSGPFSEQYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINSTHPQLLELLNRLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPGTFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPAGAPGAQAAPQAQAGPTTNPAYSSYQPTPTPGYQNVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTTLPGQDASLPAQQPYITGQQPMYQQMAPSTGPPQQQPPVAQPPPTQGPPAQGNETQLISFD mint Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM. This complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes (By similarity). May contribute to the efficient recruitment of SMADs to the activin receptor complex FD61BEC121F37E67 hgs-snap25 2 4 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain H2 REGION range MINT-418499: original sequence: 443-541 : QSINSTHPQLLELLNRLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEK Stoichiometry: 1.0 3 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction mint hgs-snap25-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain H2 REGION range MINT-418512: original sequence: 443-541 : QSINSTHPQLLELLNRLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint